Skip to content
GiveCare

·Care Policy Radar · Updated 2026-06-18

Care Policy Radar

A readable feed of policy and systems changes that affect families, caregivers, care organizations, advocates, and the burden around care. It turns legislation and regulatory movement into plain-language briefs about what changed and where action could matter.

InvisibleBench AI-supported care context

Policy feed

110/110 rows · 8 domains · 46 jurisdictions

Next: NIH National Plan to End Parkinson's implementation (Advisory Council meeting June 29, 2026)

Movement

All domains · 52/110 dated · texture by domain

2018-0158 undated2027-07
01

New Jersey CARE Act hospital caregiver rights

ImplementationRule effective January 16, 2018Live · Effectiveofficial · stale

New Jersey's CARE Act and hospital licensing rules require hospitals to offer eligible patients an opportunity to designate a caregiver and receive discharge-related training or instruction.

What changes for caregivers
NJ's CARE Act and hospital licensing rules require hospitals to offer eligible patients an opportunity to designate a caregiver and provide discharge-related caregiver training or instruction.
Why it matters
This anchors caregiver ID and discharge-process rights in NJ, but it should not be presented as general proxy authority.
02

New York CARE Act hospital caregiver rights

LegislationCurrent statutory textLive · Effectiveofficial · stale

New York law requires hospitals to offer patients a chance to identify a caregiver and to involve that caregiver in discharge-related notice and after-care instruction when consent rules are met.

What changes for caregivers
NY law requires hospitals to offer patients a chance to identify a caregiver, record that caregiver, request consent for information release, notify the caregiver of discharge or transfer, and offer after-care instruction.
Why it matters
This is a practical 'who gets included at discharge?' rights row, with consent and no-obligation limits.
03

Washington My Health My Data Act

LegislationEffective 2024-03-31Live · Effectiveofficial · updated

Consumer health data regime relevant to non-HIPAA health, mental health, and caregiving applications.

What changes for caregivers
Consumer health data regime relevant to non-HIPAA health, mental health, and caregiving applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
04

Nevada SB 370 consumer health data law

LegislationEffective 2024-03-31Live · Effectiveofficial · updated

Consumer health data law relevant to non-HIPAA mental health and caregiving applications.

What changes for caregivers
Consumer health data law relevant to non-HIPAA mental health and caregiving applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
05

New Jersey Domestic Workers' Bill of Rights in home care

ImplementationEffective July 1, 2024; rulemaking implementation ongoingLive · Effectiveofficial · updated

New Jersey's Domestic Workers' Bill of Rights applies workplace protections to many in-home care and household workers, including workers caring for older or disabled people in private homes.

What changes for caregivers
New Jersey extended wage, notice, anti-retaliation, and working-condition protections to covered domestic workers, including many workers providing care in private homes.
Why it matters
Caregivers who hire or coordinate paid help at home need to understand worker-rights obligations because home-care continuity depends on a lawful, stable workforce.
06

CMS GUIDE dementia caregiver model implementation

ImplementationEight-year model began July 1, 2024Live · Implementingofficial · updated

CMS is implementing the GUIDE Model for dementia care, including care navigation, caregiver training, 24/7 support lines, and respite services for eligible participants.

What changes for caregivers
CMS launched an eight-year dementia care model that pays participating organizations for comprehensive care management, caregiver support, 24/7 access, and respite for eligible beneficiaries.
Why it matters
Dementia caregiver burden is shaped by navigation, crisis support, and respite availability, not only by medical visits.
07

HHS Section 504 health-care disability rule

RegulationFinal rule effective July 8, 2024Live · Effectiveofficial · updated

HHS finalized updated Section 504 rules for HHS-funded health programs, including disability nondiscrimination protections for medical treatment decisions and accessible health services.

What changes for caregivers
HHS updated Section 504 rules for recipients of HHS funding, including protections against disability-based bias in medical treatment decisions and requirements around accessible services, communication, and program access.
Why it matters
Caregivers often become the practical advocate when disability bias, inaccessible communication, or representative access blocks care.
08

BOLD dementia public-health infrastructure reauthorized

LegislationAuthorized for FY2025-FY2029Live · Effectiveofficial · updated

Federal law reauthorized BOLD dementia public-health infrastructure, which supports state and local dementia risk reduction, early detection, and caregiving programs.

What changes for caregivers
Public Law 118-142 extends the federal BOLD dementia infrastructure program that CDC frames around risk reduction, early detection, avoidable hospitalization prevention, and dementia caregiving.
Why it matters
This is not a direct family entitlement, but it shapes state and local dementia education, data, and caregiver-support infrastructure.
09

California AB 3030 healthcare GenAI communication disclosure

LegislationEffective 2025-01-01Live · Effectiveofficial · updated

Requires health facilities and clinics to include a GenAI disclaimer for patient health-status communications unless reviewed by a licensed or certified provider.

What changes for caregivers
Requires health facilities and clinics to include a GenAI disclaimer for patient health-status communications unless reviewed by a licensed or certified provider.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
10

Elizabeth Dole Act caregiver and home-care implementation

ImplementationImplementation active after January 2, 2025 enactmentLive · Implementingofficial · updated

VA is implementing the Elizabeth Dole Act, a broad veterans package with caregiver, home-care, benefits, and access provisions.

What changes for caregivers
VA describes the law as addressing healthcare, economic opportunities, support for caregivers, and veteran homelessness, with multiple implementation workstreams.
Why it matters
Veteran caregivers need to know which provisions are live, which are still being implemented, and where VA navigation changes affect real access.
11

New York regional home-care reimbursement proposal

Legislation2025-2026 session; in Senate HealthProposed · Proposedofficial · updated

New York S3599 would require DOH to set regional minimum hourly base reimbursement rates for home-care providers employing home-care and personal-care aides.

What changes for caregivers
The bill would direct DOH to establish and publish regional minimum hourly base reimbursement rates and seek CMS approval for state-directed payments where applicable.
Why it matters
Payment-rate uncertainty can affect provider contracting, worker retention, and whether consumers can actually staff authorized home-care hours.
12

Credit for Caring Act caregiver tax-credit proposal

Legislation119th CongressPending · Activeofficial plus tracker · updated

The bipartisan Credit for Caring Act would create a federal tax credit for eligible working family caregivers.

What changes for caregivers
The proposal would offset some caregiving expenses such as home care aides, adult day services, home modifications, transportation, and respite.
Why it matters
Caregivers often absorb out-of-pocket costs while reducing work hours; tax policy is one route for direct economic support.
13

ABC Act caregiver administrative-burden proposal

Legislation119th CongressPending · Activeofficial · updated

The ABC Act would require CMS and SSA to review and simplify forms, processes, and communications that family caregivers use to navigate major federal benefit programs.

What changes for caregivers
H.R.2491 and S.1227 would require CMS and SSA to simplify forms, processes, and communications for family caregivers helping people use Medicare, Medicaid, CHIP, and Social Security programs.
Why it matters
This targets paperwork friction rather than benefit expansion, making it a strong row for navigation burden and caregiver time.
14

New Jersey nursing-home staffing reporting and enforcement

EnforcementEnforcement active; OSC action posted June 19, 2025Live · Effectiveofficial · updated

New Jersey's nursing-home staffing-ratio law is paired with public staffing reports and Medicaid enforcement activity for serious staffing-violation cases.

What changes for caregivers
New Jersey's nursing-home staffing-ratio law remains paired with DOH public staffing reports, and the State Comptroller has used Medicaid recovery and payment withholding in serious staffing-violation cases.
Why it matters
For families, staffing ratios are not just a policy slogan; New Jersey has official public reports and an enforcement path that can affect facilities receiving Medicaid funds.
15

Nevada AB 406 AI restrictions in mental and behavioral health

LegislationEffective 2025-06-29Live · Effectiveofficial · updated

Restricts AI systems programmed to provide professional mental or behavioral health care, including marketing and direct care interactions.

What changes for caregivers
Restricts AI systems programmed to provide professional mental or behavioral health care, including marketing and direct care interactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
16

Illinois WOPR Act - HB 1806

LegislationEffective 2025-08-01Live · Effectiveofficial · updated

Restricts AI in therapy and psychotherapy, reserves therapeutic services for licensed professionals, and creates civil penalties.

What changes for caregivers
Restricts AI in therapy and psychotherapy, reserves therapeutic services for licensed professionals, and creates civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
17

New York CDPAP single fiscal intermediary implementation

ImplementationImplementation activeLive · Implementingofficial · updated

New York continues implementation of Consumer Directed Personal Assistance Program changes that affect how consumers and personal assistants register, document, and get paid.

What changes for caregivers
CDPAP administrative rules and transition materials changed the pathway for consumer-directed home care and personal assistant enrollment.
Why it matters
A registration, payroll, or documentation failure can disrupt care at home even when the underlying service need has not changed.
18

CMS hospital discharge-planning survey guidance

GuidanceCMS QSO memo dated September 5, 2025Live · Effectiveofficial · updated

CMS revised hospital survey guidance for discharge planning, including guidance relevant to caregiver or support-person involvement and safe post-discharge transitions.

What changes for caregivers
CMS revised State Operations Manual Appendix A guidance for hospital surveyors, including discharge-planning interpretive guidance that references caregiver or support-person involvement and safe post-discharge transitions.
Why it matters
Unsafe discharge is a recurring caregiver burden; this gives a source-backed accountability hook for explaining what hospitals are expected to document and discuss.
19

Federal FAMILY Act paid-leave proposal

Legislation119th CongressPending · Activeofficial · updated

The FAMILY Act would create federal paid family and medical leave benefits, including leave to care for a qualified family member with a serious health condition.

What changes for caregivers
H.R.5390 and S.2823 would establish a national paid family and medical leave insurance benefit, including caregiving leave for a qualified family member.
Why it matters
Direct national wage replacement would be material for working caregivers, but this is proposed only and should be compared with state leave programs.
20

Medicare hospice HOPE assessment implementation

ImplementationHOPE replaced HIS beginning October 1, 2025Live · Implementingofficial · updated

CMS moved Medicare hospice quality reporting from the Hospice Item Set to the HOPE patient assessment workflow for relevant admissions, update visits, and discharges.

What changes for caregivers
CMS moved Medicare hospice quality reporting from HIS to the HOPE patient assessment workflow for relevant hospice admissions, update visits, and discharges.
Why it matters
Hospices now have new documentation and submission workflows that may affect care-plan timing, quality reporting, and administrative load around hospice care.
21

New York General Business Law Article 47, section 1700

LegislationEffective 2025-11-05Live · Effectiveofficial · updated

Defines AI companions around sustained human-like relationships, prior-interaction memory, emotion-based questions, and personal dialogue.

What changes for caregivers
Defines AI companions around sustained human-like relationships, prior-interaction memory, emotion-based questions, and personal dialogue.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
22

New York Paid Family Leave 2026 family-care rates

Implementation2026 benefit yearLive · Effectiveofficial · updated

New York's 2026 Paid Family Leave rates set the maximum weekly benefit and employee contribution cap for workers taking family-care leave.

What changes for caregivers
NY's 2026 PFL maximum weekly benefit is $1,228.53, with an employee contribution rate of 0.432 percent capped at $411.91; family-care leave remains up to 12 weeks at 67 percent of pay up to the cap.
Why it matters
Families need wage-cap details and form timing before leave starts, especially when a care episode collides with work income.
23

New Jersey Family Leave Insurance 2026 family-care rates

Implementation2026 rates effectiveLive · Effectiveofficial · updated

New Jersey's 2026 Family Leave Insurance rates set the weekly benefit cap for workers taking paid leave to care for a seriously ill or injured loved one.

What changes for caregivers
NJ's 2026 maximum weekly TDI and FLI benefit is $1,119, and FLI eligibility uses wage or base-year earnings thresholds. FLI provides wage replacement, not job protection by itself.
Why it matters
Caregivers often confuse FLI cash benefits with FMLA or NJFLA job protection, which changes the practical next step.
24

New Hampshire HB 143 responsive generative communication

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Adds child-safety restrictions involving responsive generative communication and AI-enabled interaction with minors.

What changes for caregivers
Adds child-safety restrictions involving responsive generative communication and AI-enabled interaction with minors.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
25

California SB 243 companion chatbot safety law

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Requires companion chatbot disclosures, suicide and self-harm safeguards, protections for minors, and reporting obligations for operators.

What changes for caregivers
Requires companion chatbot disclosures, suicide and self-harm safeguards, protections for minors, and reporting obligations for operators.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
26

California AB 489 artificial intelligence health-care title protection

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Restricts AI systems from representing themselves with licensed health-care titles or implying licensed clinical authority.

What changes for caregivers
Restricts AI systems from representing themselves with licensed health-care titles or implying licensed clinical authority.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
27

Texas HB 149 Texas Responsible Artificial Intelligence Governance Act

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Creates a state AI regulatory framework, disclosure requirements for certain AI users including health care service providers, prohibited AI uses, enforcement, a sandbox, and an AI council.

What changes for caregivers
Creates a state AI regulatory framework, disclosure requirements for certain AI users including health care service providers, prohibited AI uses, enforcement, a sandbox, and an AI council.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
28

New Jersey Personal Preference Program fiscal-intermediary transition

ImplementationPPP FI transition workgroup active in 2026Live · Implementingofficial · new

New Jersey's Medicaid Personal Preference Program is running fiscal-intermediary transition resources and workgroups for self-directed personal care participants and workers.

What changes for caregivers
DMAHS posted PPP fiscal-intermediary transition resources; January 2026 materials describe Horizon NJ Health member transition from PPL to Palco and PPP reimbursement-rate changes effective January 1, 2026.
Why it matters
Fiscal-intermediary changes can disrupt enrollment, payroll, timesheets, and worker continuity even when a member's underlying personal-care need has not changed.
29

CMS repeals federal nursing-home minimum staffing provisions

RegulationEffective February 2, 2026Live · Effectiveofficial · updated

CMS issued an interim final rule removing the 2024 federal 24/7 RN and HPRD minimum staffing provisions after a public-law moratorium and litigation changed enforceability.

What changes for caregivers
CMS issued an interim final rule removing the 2024 federal 24/7 RN and HPRD minimum staffing provisions after a public-law moratorium and litigation changed enforceability.
Why it matters
Families may still see staffing problems, but the federal minimum-staffing baseline should not be described as currently enforceable; state rules, inspection findings, PBJ staffing data, and complaint routes become more important.
30

ALS Better Care Act reintroduced

Legislation119th CongressProposed · Proposedofficial plus tracker · new

Federal lawmakers reintroduced legislation to create a supplemental Medicare payment for multidisciplinary ALS care.

What changes for caregivers
The bill would support ALS clinics with a supplemental Medicare payment intended to sustain team-based care.
Why it matters
ALS caregivers often coordinate respiratory, mobility, nutrition, communication, social work, and palliative needs; clinic access can change the entire care plan.
31

Lifespan Respite Care reauthorized through FY2030

LegislationAuthorized through FY2030Live · Effectiveofficial · new

Congress reauthorized the federal Lifespan Respite Care Program through fiscal year 2030 and clarified that caregivers under 18 may be eligible for respite services.

What changes for caregivers
The program was renewed through FY2030, with language expanding the family caregiver definition from unpaid adult to unpaid individual.
Why it matters
Respite is a practical pressure valve for caregivers; the under-18 clarification also makes youth caregiving visible in federal program design.
32

New York nursing-home staffing and direct-care spending requirements

RegulationOngoing; staffing law current revision February 27, 2026Live · Effectiveofficial · updated

New York law requires nursing homes to maintain minimum staffing hours and follow direct-care spending rules with audit and recoupment mechanisms.

What changes for caregivers
New York law requires nursing homes to maintain minimum staffing hours and publicly post staffing information; separate direct-care spending rules require minimum spending on direct resident care and resident-facing staffing, with audit and recoupment mechanisms.
Why it matters
This is a state-level accountability lane families can use to understand staffing, resident-facing spending, and why facility quality concerns may trigger DOH oversight rather than only federal action.
33

New York Serious Illness Care Equity Act proposal

LegislationAssembly companion referred March 6, 2026; Senate bill activePending · Activeofficial · new

New York bills would create a statewide advance care planning public awareness campaign and community-based outreach grants.

What changes for caregivers
Proposed legislation would operationalize a statewide advance care planning public awareness campaign and create community-based outreach grants.
Why it matters
Advance planning burden often falls on families late; multilingual community navigation could make proxy and care-preference documentation more reachable.
34

New York palliative and hospice access standards proposal

LegislationA10316 referred February 20, 2026; S9621 introduced March 30, 2026Pending · Activeofficial · new

New York bills would strengthen identification, documentation, counseling, referral, reporting, and demonstration-project rules for palliative and hospice access.

What changes for caregivers
Proposed legislation would amend NY Public Health Law to strengthen identification, documentation, counseling, referral, reporting, and demonstration-project rules for palliative and hospice access.
Why it matters
If enacted, facilities would face clearer serious-illness referral workflows and families could get earlier palliative or hospice conversations.
35

NJ FamilyCare community-based palliative care benefit

ImplementationBenefit available April 1, 2026Live · Implementingofficial · new

New Jersey implemented a Medicaid/NJ FamilyCare community-based palliative care benefit for members with serious health conditions, available alongside current treatment.

What changes for caregivers
New Jersey implemented a Medicaid/NJ FamilyCare community-based palliative care benefit for members with serious health conditions, available alongside current treatment and outside the hospice benefit.
Why it matters
This creates a concrete benefit route for symptom management, goal-setting, and care coordination before hospice eligibility.
36

NIH National Plan to End Parkinson's implementation

ImplementationAdvisory Council meeting June 29, 2026Live · Implementingofficial · new

NIH is leading implementation of the National Plan to End Parkinson's Act, including an advisory council and national planning process for Parkinson's research, care, and services.

What changes for caregivers
NIH is implementing Public Law 118-66 through a National Plan process and advisory council focused on Parkinson's research, care, and services.
Why it matters
The implementation process includes care coordination, diagnosis, caregiver and family impact, and Parkinson's-related dementia, making it a strong specialty-care pathway row.
37

Vermont H.814 mental health chatbot regulation

LegislationEffective 2026-07-01Live · Effective Soonofficial · updated

Regulates mental health chatbots, including representations about psychotherapy or treatment and conduct by chatbot suppliers.

What changes for caregivers
Regulates mental health chatbots, including representations about psychotherapy or treatment and conduct by chatbot suppliers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
38

Tennessee SB 1580 AI mental-health professional restriction

LegislationEffective 2026-07-01Live · Effective Soonofficial · updated

Restricts artificial intelligence systems from representing themselves as licensed mental-health professionals or providing certain professional mental-health services.

What changes for caregivers
Restricts artificial intelligence systems from representing themselves as licensed mental-health professionals or providing certain professional mental-health services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
39

New York Medical Aid in Dying implementation

ImplementationEffective August 5, 2026Live · Effective Soonofficial · new

New York signed S.138/A.136 and is moving from passage to implementation for terminally ill adults who may request medical aid in dying.

What changes for caregivers
Medical aid in dying is moving into an implementation window, with patient-request safeguards, provider participation rules, and Department of Health preparation work becoming operational concerns.
Why it matters
Families and care organizations need plain-language explanation before the effective date, especially around eligibility, documentation, opt-outs, referrals, and caregiver roles.
40

NJ FamilyCare federal eligibility changes

ImplementationFirst changes begin October 1, 2026Live · Effective Soonofficial · new

New Jersey is preparing members for federal Medicaid eligibility changes that begin in fall 2026 and continue into 2027.

What changes for caregivers
NJ FamilyCare warns that some eligibility rules change starting October 1, 2026, with community-engagement and six-month renewal changes beginning January 1, 2027 for certain adults.
Why it matters
Care recipients who lose coverage or miss renewal steps may also lose home care, medications, transport, or other supports caregivers rely on.
41

CMS Medicaid community-engagement interim final rule

RegulationStates generally implement no later than January 1, 2027Live · Effective Soonofficial · new

CMS issued an interim final rule for a new Medicaid community-engagement condition for certain adults, with state implementation generally due by January 1, 2027.

What changes for caregivers
CMS says states must implement an 80-hour monthly community-engagement requirement for certain Medicaid adults, with exemptions and state outreach requirements.
Why it matters
Coverage paperwork and renewal risk can cascade into loss of medications, home care, transportation, or other supports caregivers rely on.
42

New York ALS and motor neuron disease registry

LegislationPublic registry website due by January 1, 2027Live · Implementingofficial · new

New York enacted an ALS and motor neuron disease registry with provider reporting, patient notice, opt-out, confidentiality rules, and a public website deadline.

What changes for caregivers
New York signed Chapter 478 of 2025 requiring DOH to establish an ALS and motor neuron disease registry with provider reporting, patient notice, opt-out process, confidentiality rules, and a public website deadline.
Why it matters
ALS families face fast-moving care needs; better incidence and prevalence data can affect state service planning and research pathways without changing benefits by itself.
43

New York frontotemporal degeneration registry

LegislationPublic registry website due by January 1, 2027Live · Implementingofficial · new

New York enacted a frontotemporal degeneration registry and directed DOH to publish registry information and family resources through a public webpage.

What changes for caregivers
New York signed Chapter 479 of 2025 establishing an FTD registry and directing DOH to publish registry information and family resources through a public webpage.
Why it matters
FTD is often misdiagnosed and heavily caregiver-intensive; the row connects neurodegenerative disease policy to diagnosis delay, family resource navigation, and public data.
44

Washington HB 2225 AI companion chatbots

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Requires clear and recurring AI companion disclosures, minor protections, limits on manipulative engagement, self-harm protocols, and public protocol reporting.

What changes for caregivers
Requires clear and recurring AI companion disclosures, minor protections, limits on manipulative engagement, self-harm protocols, and public protocol reporting.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
45

Connecticut SB 5 artificial intelligence omnibus law

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Includes companion chatbot duties, including notice, protections around sustained engagement, and safety expectations for vulnerable users.

What changes for caregivers
Includes companion chatbot duties, including notice, protections around sustained engagement, and safety expectations for vulnerable users.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
46

Oregon SB 1546 artificial intelligence companions

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Requires notice that users are interacting with artificial output, self-harm detection and response protocols, minor safeguards, annual reports, and user actions for ascertainable harm.

What changes for caregivers
Requires notice that users are interacting with artificial output, self-harm detection and response protocols, minor safeguards, annual reports, and user actions for ascertainable harm.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
47

Colorado SB26-189 automated decision-making technology

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Repeals and reenacts Colorado AI Act provisions as an automated decision-making technology framework with transparency and consumer-rights obligations.

What changes for caregivers
Repeals and reenacts Colorado AI Act provisions as an automated decision-making technology framework with transparency and consumer-rights obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
48

Idaho S 1297 Conversational Artificial Intelligence Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Adopts conversational AI safety requirements for public conversational AI services, including disclosure and youth-safety obligations.

What changes for caregivers
Adopts conversational AI safety requirements for public conversational AI services, including disclosure and youth-safety obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
49

Nebraska LB 525 Conversational Artificial Intelligence Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Adopts the Conversational Artificial Intelligence Safety Act, defining public conversational AI services and related operator obligations.

What changes for caregivers
Adopts the Conversational Artificial Intelligence Safety Act, defining public conversational AI services and related operator obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
50

Iowa SF 2417 Conversational Artificial Intelligence Safety Act

LegislationApplies 2027-07-01Live · Effective Soonofficial · updated

Adopts public conversational AI service requirements, including operator duties for disclosure and safety.

What changes for caregivers
Adopts public conversational AI service requirements, including operator duties for disclosure and safety.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
51

Georgia SB 540 Online Internet Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Creates duties for public conversational AI services, including disclosure and child-safety requirements for certain AI interactions.

What changes for caregivers
Creates duties for public conversational AI services, including disclosure and child-safety requirements for certain AI interactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
52

CMS Medicaid Access Rule HCBS implementation

RegulationState HCBS payment reporting phase-in starts July 9, 2027Live · Implementingofficial · updated

CMS is phasing in national Medicaid access requirements for HCBS reporting, service timeliness, waiting lists, and direct-care payment standards.

What changes for caregivers
CMS finalized the Medicaid Access Rule, including HCBS reporting on waiting lists and service timeliness plus phased direct-care compensation reporting and an eventual 80 percent payment-adequacy standard for certain HCBS services.
Why it matters
This is a national implementation lane for whether Medicaid home-care dollars reach the workforce and whether states can show HCBS access problems clearly.
53

Maine AI chatbot disclosure in consumer transactions

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Requires clear and conspicuous notice when an AI chatbot may mislead a reasonable consumer into believing they are engaging with a human.

What changes for caregivers
Requires clear and conspicuous notice when an AI chatbot may mislead a reasonable consumer into believing they are engaging with a human.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
54

Maine LD 2082 AI in mental health services

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Public Law Chapter 687 regulates the use of AI in providing certain mental health services and limits therapy or psychotherapy use to licensed professional oversight.

What changes for caregivers
Public Law Chapter 687 regulates the use of AI in providing certain mental health services and limits therapy or psychotherapy use to licensed professional oversight.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
55

Massachusetts S264 AI chatbot consumer protections

LegislationActive sessionProposed · Proposedtracker only · updated

Would establish protections for consumers interacting with artificial intelligence chatbots.

What changes for caregivers
Would establish protections for consumers interacting with artificial intelligence chatbots.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
56

Massachusetts S2632 AI in healthcare decision-making

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of AI and other software tools in healthcare decision-making.

What changes for caregivers
Would regulate the use of AI and other software tools in healthcare decision-making.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
57

Massachusetts S250 consumer health data proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would establish consumer health data protections relevant to non-HIPAA care and wellness applications.

What changes for caregivers
Would establish consumer health data protections relevant to non-HIPAA care and wellness applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
58

Montana SB 163 biometric, genetic, and neural data privacy

LegislationNo dated trigger capturedLive · Effectivetracker only · updated

Revises privacy law related to biometric, genetic, and neural data.

What changes for caregivers
Revises privacy law related to biometric, genetic, and neural data.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
59

South Dakota SB 168 chatbot use by minors

LegislationActive sessionPending · Activetracker only · updated

Would have regulated chatbot use by minors; deferred to the 41st legislative day.

What changes for caregivers
Would have regulated chatbot use by minors; deferred to the 41st legislative day.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
60

South Dakota SB 170 chatbot consumer notice

LegislationActive sessionPending · Activetracker only · updated

Would have required notice to consumers interacting with human-simulating chatbots or computer technologies.

What changes for caregivers
Would have required notice to consumers interacting with human-simulating chatbots or computer technologies.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
61

Minnesota SF4997 AI chatbot technology requirements

LegislationActive sessionProposed · Proposedtracker only · updated

Would establish requirements for artificial intelligence chatbot technology.

What changes for caregivers
Would establish requirements for artificial intelligence chatbot technology.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
62

Minnesota HF3893 AI psychotherapy regulation

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate use of artificial intelligence in psychotherapy services and provide civil penalties.

What changes for caregivers
Would regulate use of artificial intelligence in psychotherapy services and provide civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
63

Minnesota HF2700 consumer health data protections

LegislationActive sessionProposed · Proposedtracker only · updated

Would modify the Minnesota Consumer Data Privacy Act to treat consumer health data as sensitive data and add protections.

What changes for caregivers
Would modify the Minnesota Consumer Data Privacy Act to treat consumer health data as sensitive data and add protections.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
64

Wisconsin SB 1066 AI prior authorization proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate use of AI to deny prior authorization for medical necessity or experimental status.

What changes for caregivers
Would regulate use of AI to deny prior authorization for medical necessity or experimental status.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
65

Wisconsin AB 965 child relationship-AI bill

LegislationActive sessionPending · Activetracker only · updated

Would have regulated AI systems that simulate humanlike relationships with children; failed to pass in 2026.

What changes for caregivers
Would have regulated AI systems that simulate humanlike relationships with children; failed to pass in 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
66

Michigan SB 760 companion chatbot proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Tracked as a direct companion chatbot bill with disclosure and safety implications for AI systems that simulate relationship-like engagement.

What changes for caregivers
Tracked as a direct companion chatbot bill with disclosure and safety implications for AI systems that simulate relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
67

Connecticut Consumer health data statute

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Defines consumer health data to include data used to identify a consumer physical or mental health condition or diagnosis.

What changes for caregivers
Defines consumer health data to include data used to identify a consumer physical or mental health condition or diagnosis.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
68

Connecticut SB 86 companion chatbot bill analysis

LegislationActive sessionProposed · Proposedofficial · updated

2026 bill analysis describes disclosure duties and restrictions for operators that make companion chatbots available to certain minors.

What changes for caregivers
2026 bill analysis describes disclosure duties and restrictions for operators that make companion chatbots available to certain minors.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
69

Rhode Island S2195 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate companion AI chatbot operators, including disclosure, minor-safety, and crisis-response obligations.

What changes for caregivers
Would regulate companion AI chatbot operators, including disclosure, minor-safety, and crisis-response obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
70

Rhode Island H7350 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedtracker only · updated

House companion proposal covering AI chatbots used for companionship or relationship-like engagement.

What changes for caregivers
House companion proposal covering AI chatbots used for companionship or relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
71

Indiana HB 1271 payment of health claims

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Prohibits providers from using an automated process, system, or tool to submit a health benefits claim without review by a provider or another responsible person.

What changes for caregivers
Prohibits providers from using an automated process, system, or tool to submit a health benefits claim without review by a provider or another responsible person.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
72

Ohio HB 525 AI in therapy services

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of artificial intelligence in therapy services.

What changes for caregivers
Would regulate the use of artificial intelligence in therapy services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
73

Ohio SB 164 AI use by health insurers

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of artificial intelligence by health insurers.

What changes for caregivers
Would regulate the use of artificial intelligence by health insurers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
74

Pennsylvania HB 2006 chatbot use in consumer transactions

LegislationActive sessionProposed · Proposedtracker only · updated

Proposed chatbot disclosure bill in consumer transactions.

What changes for caregivers
Proposed chatbot disclosure bill in consumer transactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
75

Pennsylvania SAFECHAT Act

LegislationActive sessionProposed · Proposedtracker only · updated

Minor-focused AI chatbot safeguard proposal advanced by the Pennsylvania Senate in 2026.

What changes for caregivers
Minor-focused AI chatbot safeguard proposal advanced by the Pennsylvania Senate in 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
76

New Jersey A4732 companion chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion chatbots and establish user notice and safety expectations for AI systems that simulate relationship-like engagement.

What changes for caregivers
Would regulate companion chatbots and establish user notice and safety expectations for AI systems that simulate relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
77

New Jersey S735 therapeutic chatbots and social AI companions

LegislationActive sessionProposed · Proposedofficial · updated

Proposed bill regulating therapeutic chatbots and social AI companions.

What changes for caregivers
Proposed bill regulating therapeutic chatbots and social AI companions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
78

Utah HB 452 mental health chatbots

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Defines mental health chatbots, requires AI and non-human disclosures, limits sale/sharing of user input and health information, restricts targeted ads, and creates policy and documentation requirements.

What changes for caregivers
Defines mental health chatbots, requires AI and non-human disclosures, limits sale/sharing of user input and health information, restricts targeted ads, and creates policy and documentation requirements.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
79

Kansas HB 2671 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Defines companion AI chatbot around companionship or mental-health therapeutic communication and proposes related safeguards.

What changes for caregivers
Defines companion AI chatbot around companionship or mental-health therapeutic communication and proposes related safeguards.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
80

Missouri HB 2032 companion chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion AI chatbot operators and safety obligations for AI systems used for companionship or therapeutic communication.

What changes for caregivers
Would regulate companion AI chatbot operators and safety obligations for AI systems used for companionship or therapeutic communication.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
81

Kentucky HB 227 companion AI chatbots

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion AI chatbot operators, including disclosures and safeguards around minor users and therapeutic communications.

What changes for caregivers
Would regulate companion AI chatbot operators, including disclosures and safeguards around minor users and therapeutic communications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
82

West Virginia HB 4770 mental health care AI limitations

LegislationActive sessionProposed · Proposedtracker only · updated

Would limit use of AI and AI technology to deliver mental health care, while allowing certain administrative support functions.

What changes for caregivers
Would limit use of AI and AI technology to deliver mental health care, while allowing certain administrative support functions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
83

Maryland HB 952 companion chatbot safeguards

LegislationActive sessionProposed · Proposedofficial · updated

Would require companion chatbot disclosures, suicide and self-harm response protocols, and related operator obligations.

What changes for caregivers
Would require companion chatbot disclosures, suicide and self-harm response protocols, and related operator obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
84

Arizona HB 2737 chatbot regulations

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate chatbot personal-data practices and requirements for consumer-facing chatbot systems.

What changes for caregivers
Would regulate chatbot personal-data practices and requirements for consumer-facing chatbot systems.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
85

Arizona HB 2311 AI service disclosures

LegislationActive sessionProposed · Proposedtracker only · updated

Would require disclosures and related requirements for artificial intelligence services.

What changes for caregivers
Would require disclosures and related requirements for artificial intelligence services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
86

New Mexico HB 174 Chatbot Safety Act

LegislationActive sessionPending · Activetracker only · updated

Would have created chatbot safety requirements; action was postponed indefinitely in January 2026.

What changes for caregivers
Would have created chatbot safety requirements; action was postponed indefinitely in January 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
87

Oklahoma HB 3544 AI companions and minors

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate artificial intelligence companions, minors, safety requirements, and civil penalties.

What changes for caregivers
Would regulate artificial intelligence companions, minors, safety requirements, and civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
88

Oklahoma SB 1521 AI minor safeguards and disclosure

LegislationActive sessionProposed · Proposedtracker only · updated

Would require AI operator disclosures, preventive measures for minor account holders, prohibitions, attorney general enforcement, and civil penalties.

What changes for caregivers
Would require AI operator disclosures, preventive measures for minor account holders, prohibitions, attorney general enforcement, and civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
89

Oklahoma SB 2037 AI informed consent in health care

LegislationActive sessionProposed · Proposedtracker only · updated

Would require informed consent for AI use by licensed mental health professionals or health care providers and define authorized and prohibited uses.

What changes for caregivers
Would require informed consent for AI use by licensed mental health professionals or health care providers and define authorized and prohibited uses.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
90

Virginia SB 796 Artificial Intelligence Companion Chatbots and Minors Act

LegislationActive sessionProposed · Proposedtracker only · updated

Would require age verification for companion chatbots, loyalty-oriented safeguards for widely used chatbots, crisis resource actions, and incident reporting.

What changes for caregivers
Would require age verification for companion chatbots, loyalty-oriented safeguards for widely used chatbots, crisis resource actions, and incident reporting.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
91

North Carolina S 624 AI chatbots

LegislationActive sessionProposed · Proposedtracker only · updated

Tracked as pending AI chatbot regulation in 2026 state legislation trackers.

What changes for caregivers
Tracked as pending AI chatbot regulation in 2026 state legislation trackers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
92

Louisiana SB 5 mental health chatbot proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate mental health chatbots that use artificial intelligence technology.

What changes for caregivers
Would regulate mental health chatbots that use artificial intelligence technology.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
93

Louisiana HB 1188 chatbot protections for minors

LegislationActive sessionProposed · Proposedtracker only · updated

Would provide protections for minors regarding use of chatbots.

What changes for caregivers
Would provide protections for minors regarding use of chatbots.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
94

Louisiana HB 197 AI use by health care providers

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of artificial intelligence by health care providers.

What changes for caregivers
Would regulate the use of artificial intelligence by health care providers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
95

Mississippi HB 1720 mental and behavioral health AI proposal

LegislationActive sessionPending · Activetracker only · updated

Would have prohibited use of artificial intelligence in professional mental and behavioral health care.

What changes for caregivers
Would have prohibited use of artificial intelligence in professional mental and behavioral health care.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
96

Alabama SB 63 health care plan AI determinations

LegislationNo dated trigger capturedLive · Effectivetracker only · updated

Regulates the use of artificial intelligence by health care plans in coverage or care-service determinations.

What changes for caregivers
Regulates the use of artificial intelligence by health care plans in coverage or care-service determinations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
97

Alabama HB 324 chatbot and therapy-chatbot requirements

LegislationActive sessionProposed · Proposedtracker only · updated

Would require chatbot age verification, safeguard protocols, therapy-chatbot requirements, and enforcement paths.

What changes for caregivers
Would require chatbot age verification, safeguard protocols, therapy-chatbot requirements, and enforcement paths.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
98

Alabama HB 263 biological and neural data proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would restrict certain disclosures, transfers, and uses of biological or neural data by health and fitness apps without express consent.

What changes for caregivers
Would restrict certain disclosures, transfers, and uses of biological or neural data by health and fitness apps without express consent.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
99

South Carolina S0896 chatbot regulation

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate chatbot systems and related consumer protections.

What changes for caregivers
Would regulate chatbot systems and related consumer protections.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
100

South Carolina S1037 protecting children from chatbots

LegislationActive sessionProposed · Proposedtracker only · updated

Would establish protections for children from chatbot harms.

What changes for caregivers
Would establish protections for children from chatbot harms.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
101

South Carolina S0788 artificial intelligence and therapy or psychotherapy

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate artificial intelligence in therapy or psychotherapy contexts.

What changes for caregivers
Would regulate artificial intelligence in therapy or psychotherapy contexts.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
102

Hawaii SB 640 AI disclosure requirements

LegislationActive sessionProposed · Proposedtracker only · updated

Introduced/proposed AI disclosure bill tracked as an adjacent transparency signal.

What changes for caregivers
Introduced/proposed AI disclosure bill tracked as an adjacent transparency signal.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
103

Florida HB 659 interactions with artificial intelligence

LegislationActive sessionPending · Activeofficial · updated

Would have required companion chatbot platform disclosures, safety protocols, age verification actions for minors, reports, and consumer enforcement paths.

What changes for caregivers
Would have required companion chatbot platform disclosures, safety protocols, age verification actions for minors, reports, and consumer enforcement paths.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
104

Federal S.2714 CHAT Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.

What changes for caregivers
Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
105

Federal S.3062 GUARD Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.

What changes for caregivers
Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
106

Federal Stopping Illegal Minor Simulations Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.

What changes for caregivers
Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
107

Federal H.R.6489 SAFE BOTs Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.

What changes for caregivers
Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
108

Federal ONC HTI-1 algorithm transparency rule

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.

What changes for caregivers
Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
109

Federal HIPAA Security Rule cybersecurity NPRM

LegislationActive sessionProposed · Proposedofficial · updated

Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.

What changes for caregivers
Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
110

Federal DOJ sensitive personal data final rule

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.

What changes for caregivers
Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.

source-backed policy rows

110

AI lane jurisdictions tier 3+

40 / 51

AI lane enacted or scheduled

21 / 51

linked source records

90

Radar scope

Policy changes that alter care burden and action.

GiveCare tracks policy and systems changes that alter what families, advocates, care organizations, and partners have to understand, decide, document, or fight for. AI policy is one lane inside the broader care systems feed.

01

End of life and serious illness

MAID, palliative care, hospice, advance directives, grief, and state effective dates.

02

Rare disease, chronic illness, and disability

ALS, Parkinson's, dementia, neurodegenerative disease, registries, disability access, and specialty-care pathways.

03

Caregiver economic support

Paid leave, tax credits, respite grants, family caregiver supports, and direct cash relief.

04

Home care and long-term services

Medicaid HCBS, CDPAP, paid family care, direct-care workforce, respite, and in-home service capacity.

05

Benefits, coverage, and access

Medicaid, Medicare, VA supports, eligibility rules, appeals, coverage limits, and program navigation.

06

Legal authority and family rights

Caregiver access, proxy authority, guardianship, privacy, discharge rights, and decision documentation.

07

AI, data, and care technology

Chatbot regulation, clinical AI, biometric access, surveillance, health-data use, and algorithmic eligibility.

08

Advocacy opportunities

Hearings, comment periods, sign-on letters, advocacy days, sponsors, committees, and coalitions.

09

Implementation changes

The practical dates and rules that change what families, care orgs, or advocates can do.

Impact taxonomy

The lens is care burden before bill status.

The radar reads each item for the pressure it creates or relieves: family psychology, access, legal authority, disease pathways, service capacity, data exposure, advocacy timing, and implementation reality.

Family burden and psychology

role straindecision fatigueanticipatory griefambiguous lossmoral distressidentity strain

Access and eligibility

MedicaidHCBSCDPAPMedicareVA supportspaperwork load

Legal authority and decision rights

caregiver accesssurrogate decisionsadvance directivesguardianshipMAIDprivacy proxies

Disease and serious-illness pathways

ALSParkinson'sdementiaregistriespalliative carehospice

Home-care capacity

respitepaid family caredirect-care workforceleavetax credits

Data, AI, and surveillance

chatbotsclinical AIhealth databiometricsmonitoringalgorithmic eligibility

Advocacy and implementation

sponsorscommitteeshearingscomment windowseffective datesagency guidance

Policy mechanics

The movement can be a bill, a rule, a budget line, or a deadline.

The radar classifies each item by how change actually happens. A passed law matters less if implementation is years away; a comment period or budget line can be the place where advocates still have leverage.

Legislation

draft billsponsorcommitteehearingmarkupfloor votesigned / vetoed

Rulemaking and regulation

proposed rulepublic commentfinal ruleagency guidancecompliance date

Budget and payment

appropriationgrantwaiverreimbursement ratepilot fundingsunset

Program administration

eligibility ruleapplication formtrainingimplementation dateappeal path

Oversight and enforcement

auditinvestigationombudsenforcement actionreporting requirement

Courts and legal pressure

lawsuitinjunctionsettlementcourt rulingconsent decree

Initial filters

ALS / rare disease / chronic illnessCaregiver supportMAID / serious illnessMedicaid / HCBS / home careLegal rights / decision authorityAI / privacy / care techNY / NJ / federal

Impact route

WatchExplainAdd to wikiPartner briefAdvocacy follow-upScenario / eval

AI / data / privacy lane

Where AI-supported care regulation is moving

The first populated lane tracks state and federal AI, chatbot, health-data, and disclosure rules that may shape caregiver support tools.

AKMEVTNHMAWAMTNDSDMNWIMINYCTRIORIDWYNEIAILINOHPANJCANVUTCOKSMOKYWVDCMDDEAZNMOKARTNVANCTXLAMSALGASCHIFL
No targeted rule captured
Adjacent proposal
Direct proposal
Binding adjacent rule
Direct enacted or scheduled rule

Scope

AI/data/privacy lane: 50 states plus DC; federal context below.

Publication rule

Official source preferred; tracker items are labeled.

Boundary

Research map only. Not legal advice.

Care standard

The AI laws are close to care, but not the whole care standard.

State bills are converging on disclosure, minors, self-harm, therapy boundaries, and sensitive data. Caregiving systems also need to account for benefits access, family burden, serious illness decisions, and implementation dates families actually feel.

01

Identity clarity

Recurring AI/not-human disclosure and resistance to identity ambiguity.

DisclosureCompanion Chatbot
02

Crisis response

Self-harm detection, crisis referrals, escalation protocol, and public reporting.

Crisis SafetyMental Health Chatbot
03

Relationship boundaries

Controls for dependency cues, manipulative engagement, minors, and simulated intimacy.

Minor SafetyCompanion Chatbot
04

Data and oversight

Consumer health data limits, health AI transparency, impact assessment, and human review.

Consumer Health DataHealthcare AiHigh Risk AiData Governance

Federal AI/data context

No single federal AI-supported care standard yet.

Federal signals are split across chatbot/minor bills, health IT transparency, HIPAA cybersecurity, and sensitive data rules. The broader radar also tracks federal caregiver support, benefits access, and disease-specific bills.

ProposedDirect care-adjacent

S.2714 CHAT Act

Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.

ProposedDirect care-adjacent

S.3062 GUARD Act

Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.

Proposedadjacent

Stopping Illegal Minor Simulations Act

Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.

Introduced June 10, 2026 by Sens. Husted, Coons, Cassidy, and Murphy; draft bill text posted by Sen. Husted.

ProposedDirect care-adjacent

H.R.6489 SAFE BOTs Act

Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.

Enactedadjacent

ONC HTI-1 algorithm transparency rule

Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.

Proposedcontext

HIPAA Security Rule cybersecurity NPRM

Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.

Enactedcontext

DOJ sensitive personal data final rule

Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.

Method

Wide scrub, curated feed.

Civic discovery

0 raw civic signals were fetched for the AI/data lane on 2026-06-17T12:04:20Z. Raw results are treated as discovery, then normalized before publication.

Official-source bias

Published entries prefer state legislature, agency, Federal Register, Congress.gov, or official bill text. Tracker sources are marked where the official source is still being resolved.

Care systems scope

Items belong when they change what families, advocates, care organizations, or partners have to understand, decide, document, or fight for. AI, data, and privacy are one lane inside that broader scope.

Update posture

This is designed as a monitored policy layer. New civic sweeps should feed a review queue before the public map changes tier or status.

Changelog

What changed in the radar.

Material updates are logged here so source coverage, lane scope, and tier movement can be audited over time.

2026-06-17

Targeted federal minor-safety refresh

Ran the civic policy sweep for post-June-5 signals and added one official federal adjacent signal from a targeted web cross-check.

  • Civic returned zero structured signals for the June 5 to June 17 window.
  • Added the SIMS Act as adjacent minor-safety context because it targets minor-simulating chatbots rather than caregiving, eligibility, or clinical claims.
  • Left state entries unchanged because no newer official state signal cleared the existing publication standard.

2026-06-05

50-state plus DC refresh

Reviewed every state and DC, expanded the public layer to 45 non-baseline jurisdictions, and left Alaska, Arkansas, Delaware, North Dakota, Wyoming, and DC as baseline pending new targeted signals.

  • Added enacted or scheduled chatbot and healthcare-AI entries for Connecticut, Georgia, Idaho, Iowa, Nebraska, and New Hampshire.
  • Added or refreshed proposal clusters in Alabama, Arizona, Louisiana, Massachusetts, Minnesota, Ohio, Oklahoma, South Carolina, West Virginia, and related monitoring states.
  • Moved dead or postponed child-chatbot proposals in Florida, Mississippi, New Mexico, South Dakota, and Wisconsin into monitor status instead of treating them as active direct rules.

2026-05-20

Tracked review window opened

Started the civic discovery window used by the public policy map and normalized visible items against state, federal, and legislative-tracker sources.

  • Structured the page around all 50 states plus DC, federal context, source links, and a standard-gap explanation.
  • Established direct, adjacent, context, and monitor classifications for care-AI policy signals.