Skip to content
GiveCare

·Care Policy Radar · Updated 2026-07-04

Care Policy Radar

A readable feed of policy and systems changes that affect families, caregivers, care organizations, advocates, and the burden around care. It turns legislation and regulatory movement into plain-language briefs about what changed and where action could matter.

InvisibleBench AI-supported care context

Policy feed

335/335 rows · 8 domains · 50 jurisdictions

Next: New York nursing-home complaint and inspection guidance (NYS Health Profiles guidance active)

Movement

All domains · 274/335 dated · texture by domain

1990-1261 undated2028-07
01

Massachusetts health care proxy authority

LegislationHealth care proxy law activeLive · Effectiveofficial · new

Massachusetts law lets a competent adult appoint a health care agent through a written health care proxy.

What changes for caregivers
Massachusetts gives adults a statutory route to appoint a health care agent who can make medical decisions if the person cannot make or communicate them.
Why it matters
Caregivers often need clear legal authority before hospitals, clinicians, or facilities will accept decisions during incapacity or serious illness.
02

Federal hospice plan-of-care regulation

RegulationHospice Conditions of Participation effective December 2, 2008; SOM guidance current in 2023 revisionLive · Effectiveofficial · new

Federal hospice Conditions of Participation and CMS survey guidance anchor interdisciplinary-group, individualized plan-of-care, caregiver education, and care-coordination requirements.

What changes for caregivers
CMS's hospice Conditions of Participation page identifies 42 CFR 418.3 and 418.52-116 as the regulatory framework. The CMS State Operations Manual appendix for hospices quotes and interprets 42 CFR 418.56 plan-of-care provisions, including interdisciplinary group coordination, patient and family goals, caregiver education and training, and plan-of-care review.
Why it matters
Families often experience hospice through the plan of care: who coordinates, what services are included, how goals are documented, and what training caregivers receive. The regulation row gives the corpus a federal anchor before state or provider-specific instructions are added.
03

Massachusetts palliative care and end-of-life counseling rights

LegislationCurrent statutory textLive · Effectiveofficial · new

Massachusetts law requires attending health care practitioners to offer certain terminally ill patients information and counseling about palliative care and end-of-life options.

What changes for caregivers
Massachusetts law creates a patient-information pathway around palliative care and end-of-life options for certain terminally ill patients.
Why it matters
Caregivers often need earlier, clearer conversations about goals, symptom management, hospice, palliative care, and care setting choices before a crisis discharge.
04

New York adult-home serious mental illness regulation

RegulationAdult-home serious mental illness regulation adopted January 16, 2013Live · Effectiveofficial · new

New York adopted adult-home regulations limiting large adult homes' concentration of residents with serious mental illness and requiring transition compliance planning for affected homes.

What changes for caregivers
The adopted regulation amended New York adult-home rules to limit the percentage of residents with serious mental illness in adult homes with certified capacity of 80 or more, require transitional adult homes to create and implement compliance plans acceptable to the Department, and add penalties for failure to comply with amended Part 487.
Why it matters
Serious mental illness in adult-home settings creates care-quality, transition, and family-monitoring issues. This row is a regulatory anchor for disability/chronic-condition residential-policy tracking.
05

New York Medical Assistance eligibility regulations

RegulationPart 360 effective May 7, 2014Live · Effectiveofficial · new

New York's Part 360 Medical Assistance regulations organize Medicaid application, eligibility, financial eligibility, entitlement, payment, confidentiality, and managed-care rules.

What changes for caregivers
18 NYCRR Part 360 is the state regulatory layer for Medical Assistance, including subparts for application process, eligibility requirements, financial eligibility, entitlement to Medical Assistance, payment for services, HIV/AIDS confidentiality, and Medicaid managed-care programs.
Why it matters
When a caregiver is dealing with an application, renewal, managed-care notice, or service-continuity issue, the regulation layer is often the source behind agency instructions and fair-hearing arguments.
06

New Jersey CARE Act caregiver designation legislation

LegislationNew Jersey CARE Act effective May 12, 2015Live · Effectiveofficial · new

New Jersey's CARE Act created a state hospital-discharge pathway for eligible patients to designate a caregiver and receive after-care assistance instruction before returning home.

What changes for caregivers
New Jersey's CARE Act established statutory caregiver designation, discharge-notice, and after-care assistance instruction requirements for covered hospital discharges to a patient's residence. NJDOH announced the law's effective date on May 12, 2015, and the Legislature's enrolled-law page is the official bill-text source.
Why it matters
The statute is the legal authority behind New Jersey caregiver discharge rights, while the existing implementation and regulation rows explain how NJDOH operationalized those rights in hospital licensing standards.
07

NJDOH CARE Act caregiver discharge guidance notice

GuidanceNJDOH CARE Act notice released May 12, 2015Pending · Activeofficial · new

NJDOH publicly announced that the CARE Act was effective and described the law as requiring hospitals to provide caregivers instructions and training when a loved one is discharged home.

What changes for caregivers
NJDOH's May 12, 2015 notice says the CARE Act went into effect that day and describes the law as ensuring hospitals provide caregivers instructions and training on how to care for a loved one discharged home. Later NJDOH rulemaking materials describe the Act's intent as giving hospital patients the right to designate a caregiver before discharge and giving that caregiver an opportunity to receive after-care assistance training.
Why it matters
The guidance row is the plain-language state notice families are likely to encounter before reading statutes or hospital licensing rules.
08

Illinois CARE Act hospital discharge caregiver rights

LegislationIllinois CARE Act in effectLive · Effectiveofficial plus tracker · new

Illinois' CARE Act requires hospitals to offer inpatients the opportunity to designate a caregiver who will help with aftercare at home after discharge.

What changes for caregivers
Illinois' CARE Act creates a discharge-planning lane for patients to identify a caregiver and for hospitals to connect that caregiver to aftercare information.
Why it matters
Discharge is a high-risk handoff for caregivers; Illinois adds another state comparison point for what families can ask hospitals to document and explain before the patient goes home.
09

Connecticut patient-designated caregiver discharge rights

LegislationPublic Act effective October 1, 2015Live · Effectiveofficial · new

Connecticut law gives hospital patients a route to designate a caregiver and requires discharge-related notice and instruction duties.

What changes for caregivers
Connecticut's patient-designated caregiver law requires hospitals to give patients an opportunity to identify a caregiver and connects that caregiver to discharge notice and after-care instruction duties.
Why it matters
This is another state model for explaining caregiver access at discharge, which is often when families first discover they are responsible for complex care tasks at home.
10

California hospital family caregiver discharge rights

LegislationHospital caregiver discharge rights effectiveLive · Effectiveofficial · new

California's hospital family caregiver law requires hospitals to involve a designated family caregiver in discharge planning and post-hospital care instruction when the patient consents.

What changes for caregivers
California requires hospitals to give patients an opportunity to identify a family caregiver and to include that caregiver in discharge planning and instruction when consent is provided.
Why it matters
Discharge rights determine whether caregivers receive notice, training, and instructions before taking over medical tasks at home.
11

New York CARE Act caregiver discharge implementation

ImplementationNYSDOH DAL 16-06 issued May 11, 2016Live · Effectiveofficial · new

NYSDOH reminded hospitals of CARE Act responsibilities for caregiver identification, discharge notice, and after-care instruction.

What changes for caregivers
NYSDOH's DAL 16-06 and caregiver guide operationalize the CARE Act by reminding hospitals to offer patients a chance to identify a caregiver, include that caregiver in discharge planning, notify the caregiver when discharge can be anticipated, and offer instruction in after-care tasks.
Why it matters
The implementation row separates hospital operational duties from the underlying statute, giving caregivers and care teams a source-backed place to look for what hospitals were told to do.
12

Federal Cures Act information-access legislation

LegislationPublic Law 114-255 approved December 13, 2016Live · Effectiveofficial · new

The 21st Century Cures Act is the federal statutory foundation for later health-IT interoperability, patient access, API, and information-blocking rules.

What changes for caregivers
Public Law 114-255 created the statutory base for Cures Act health-IT interoperability and information-blocking implementation; ONC's Cures Act Final Rule later implemented requirements designed to support secure access, exchange, and use of electronic health information.
Why it matters
Caregivers often depend on portal access, record sharing, discharge documents, and app-mediated health information; the Cures Act is the federal authority behind many downstream digital-access expectations.
13

Pennsylvania CARE Act hospital discharge caregiver rights

LegislationEffective April 20, 2017Live · Effectiveofficial · new

Pennsylvania's CARE Act requires hospitals to allow patients to designate a lay caregiver and provide discharge instructions for after-care tasks.

What changes for caregivers
Pennsylvania law gives hospital patients a route to identify a caregiver and requires hospitals to provide instructions for after-care tasks in the discharge plan.
Why it matters
CARE Act rows help families understand that caregiver access and discharge instruction rights vary by state and can be operationalized at hospital discharge.
14

New Jersey CARE Act hospital caregiver rights

ImplementationRule effective January 16, 2018Live · Effectiveofficial · updated

New Jersey's CARE Act and hospital licensing rules require hospitals to offer eligible patients an opportunity to designate a caregiver and receive discharge-related training or instruction.

What changes for caregivers
NJ's CARE Act and hospital licensing rules require hospitals to offer eligible patients an opportunity to designate a caregiver and provide discharge-related caregiver training or instruction.
Why it matters
This anchors caregiver ID and discharge-process rights in NJ, but it should not be presented as general proxy authority.
15

New Jersey CARE Act hospital caregiver regulations

RegulationNJDOH hospital licensing rules effective January 16, 2018Live · Effectiveofficial · new

New Jersey hospital licensing rules implement the CARE Act through N.J.A.C. 8:43G-11A, covering caregiver designation, consent, consultation, after-care training, and discharge notice.

What changes for caregivers
NJDOH adopted N.J.A.C. 8:43G-11A under the authority of N.J.S.A. 26:2H-5.24 through 5.32. The adopted rules require hospitals to offer caregiver designation, obtain consent before disclosing discharge-planning information, consult with the caregiver, offer after-care assistance training, record caregiver information in the discharge plan, and notify the caregiver before discharge or transfer when required.
Why it matters
The regulation row gives the operational rules hospitals must follow, which is distinct from the statutory authority and the existing implementation summary.
16

Alabama Medicaid fair-hearing enforcement rules

EnforcementChapter 3 Fair Hearings amended effective July 26, 2018Live · Effectiveofficial · new

Alabama Medicaid's fair-hearing rules cover hearing opportunities, written hearing requests, authorized representatives, witness rights, continuation of benefits for some timely termination appeals, decisions, and denial of hearing requests.

What changes for caregivers
Alabama Medicaid Chapter 3 provides a fair-hearing route for Medicaid recipients, applicants, and providers. It says written fair-hearing or undue-hardship requests must be received within 60 days from the notice mailing date; in recipient-eligibility termination cases, benefits may be continued pending the hearing when the request is received within 10 days of the notice and delays are not caused by the recipient or representative. The chapter also covers hearing officers, representation, witnesses, documentary hearings, 60-day decision timing with a 90-day outer limit, and denial of some hearing requests.
Why it matters
Caregivers often help a recipient read notices, gather documents, name an authorized representative, and decide whether an appeal deadline is urgent. This row gives Alabama an official appeal-process anchor without giving case-specific legal advice.
17

New York SHIELD Act data-security guidance

GuidanceAttorney General SHIELD Act guidance active; law signed July 25, 2019Pending · Activeofficial · new

The New York Attorney General's SHIELD Act guidance explains breach-notification expansion and reasonable administrative, technical, and physical safeguards for private information, including biometric and account-access data.

What changes for caregivers
The Attorney General guidance says the SHIELD Act strengthened New York data-security law by expanding breach-notice private-information categories and requiring reasonable safeguards. The guidance lists administrative, technical, and physical safeguard examples and notes the law expanded private information to include biometric information and online-account credentials.
Why it matters
Caregiver-support tools often rely on accounts, remote workflows, and sensitive household context; the SHIELD Act guidance is a state source for baseline data-security expectations even when a tool is outside a hospital record system.
18

New Jersey Medical Aid in Dying Act

LegislationMedical Aid in Dying Act effective August 1, 2019Live · Effectiveofficial · new

New Jersey's Medical Aid in Dying for the Terminally Ill Act permits a qualified terminally ill adult resident to request medication the patient may self-administer to end the patient's life, subject to statutory safeguards.

What changes for caregivers
P.L.2019, c.59 created New Jersey's Medical Aid in Dying for the Terminally Ill Act. NJDOH summarizes that the law became effective August 1, 2019 and allows an adult New Jersey resident with capacity, determined by attending and consulting physicians to be terminally ill, to obtain medication the patient may self-administer.
Why it matters
MAID is a high-risk end-of-life legal topic. The corpus needs the statute and official DOH summary as anchors before any caregiver-facing explanation of eligibility, safeguards, forms, or facility participation.
19

New York Patients' Bill of Rights caregiver regulation

Regulation10 NYCRR 405.7 effective November 13, 2019Live · Effectiveofficial · new

New York's hospital patient-rights regulation includes the right to identify a caregiver for discharge planning and post-discharge care information or instruction.

What changes for caregivers
The current NYCRR Section 405.7 page requires hospitals to provide and post patient rights and lists the right to identify a caregiver who will be included in discharge planning and post-discharge care information or instruction.
Why it matters
Putting the caregiver-discharge right in the hospital Patients' Bill of Rights makes it visible as a hospital patient-rights issue, not only a standalone CARE Act citation.
20

New York CARE Act hospital caregiver rights

LegislationCurrent statutory textLive · Effectiveofficial · updated

New York law requires hospitals to offer patients a chance to identify a caregiver and to involve that caregiver in discharge-related notice and after-care instruction when consent rules are met.

What changes for caregivers
NY law requires hospitals to offer patients a chance to identify a caregiver, record that caregiver, request consent for information release, notify the caregiver of discharge or transfer, and offer after-care instruction.
Why it matters
This is a practical 'who gets included at discharge?' rights row, with consent and no-obligation limits.
21

New Jersey Family Leave Act family-care leave

LegislationCurrent NJFLA family-care materials dated May 13, 2020Live · Effectiveofficial · new

New Jersey Division on Civil Rights materials describe job-protected family leave for workers who need time to care for a family member or equivalent-family relation with a serious health condition.

What changes for caregivers
The Division on Civil Rights NJFLA fact sheet explains that covered workers generally can take up to 12 weeks of job-protected leave in a 24-month period to care for a family member, or equivalent-family relation, with a serious health condition; DCR's NJFLA legal materials provide the statutory context.
Why it matters
New Jersey caregivers need the job-protection track separated from Family Leave Insurance cash benefits and federal FMLA, because the next step and proof burden differ.
22

New Jersey Family Leave Act notice and retaliation regulations

RegulationCurrent DCR NJFLA substantive regulationsLive · Effectiveofficial · new

New Jersey Division on Civil Rights Family Leave Act regulations address covered-employer notice, written guidance, retaliation, and complaint-processing rules for NJFLA rights.

What changes for caregivers
DCR's NJFLA regulations include employer poster and written-guidance duties, a prohibition on retaliation for seeking information, filing a complaint, or exercising NJFLA rights, and complaint processing through DCR.
Why it matters
Caregivers often need more than a benefit amount: they need to know whether an employer had notice duties and whether retaliation or refusal belongs in a DCR path.
23

New Jersey Family Leave Act complaint and enforcement path

EnforcementDCR complaint materials dated May 13, 2020Live · Effectiveofficial · new

New Jersey Division on Civil Rights materials identify complaint, retaliation, penalty, and enforcement paths when family-leave rights are denied or interfered with.

What changes for caregivers
DCR's NJFLA fact sheet points workers to NJCivilRights.gov or DCR's phone line to file a complaint; DCR legal materials describe unlawful interference or discrimination, penalties, suit or complaint options, and complaint processing.
Why it matters
When a caregiver's leave request becomes a workplace conflict, the corpus needs the official complaint route separated from benefit filing and from generic employment advice.
24

New Jersey health care service firm financial reporting law

LegislationP.L. 2020, c.132 enacted December 14, 2020Live · Effectiveofficial · new

New Jersey P.L. 2020, c.132 revised financial-reporting requirements for health care service firms that place home-care, companion-care, or personal-care workers.

What changes for caregivers
P.L. 2020, c.132 revised New Jersey financial-reporting requirements for health care service firms, and Consumer Affairs says the law requires all health care service firms to submit annual financial statements while some firms must submit audits or reports.
Why it matters
Financial-reporting oversight is not a direct caregiver benefit, but it is part of the state oversight structure for firms arranging care in private residences.
25

Oregon advance directive and health care representative forms

LegislationSB199 advance directive forms activeLive · Effectiveofficial · new

Oregon Health Authority publishes advance directive and health care representative appointment forms copied from Senate Bill 199.

What changes for caregivers
Oregon provides statutory advance directive and representative appointment forms that people can use to record preferences and appoint someone to make health care decisions.
Why it matters
Caregivers need a clear representative pathway when serious illness, dementia, or disability leaves someone unable to speak for themselves.
26

New York Paid Family Leave intermittent-leave regulation

RegulationWCB adopted 12 NYCRR 380-2.5(c) amendment October 6, 2021Live · Effectiveofficial · new

The New York Workers' Compensation Board adopted a Paid Family Leave regulation amendment clarifying how intermittent full-day leave limits are calculated.

What changes for caregivers
The Workers' Compensation Board announced adoption of amendments to 12 NYCRR 380-2.5(c), clarifying that when PFL is taken in full-day increments, the maximum number of intermittent leave days is based on the average number of days worked per week; current NY family-care guidance applies the same full-day-increment concept.
Why it matters
Intermittent caregiving is common, and the regulation affects how many leave days a worker can plan around treatments, supervision, transportation, and recovery needs.
27

New York nursing-home resident rights and abuse-reporting law

LegislationResident-rights current revision April 29, 2022; abuse-reporting current revision April 24, 2020Live · Effectiveofficial · new

New York Public Health Law sets nursing-home resident-rights requirements and abuse, mistreatment, neglect, and property-misappropriation reporting duties for residential health care facilities.

What changes for caregivers
Public Health Law 2803-c requires covered facilities to adopt, post, and implement patient rights and responsibilities; Public Health Law 2803-d requires specified facility and licensed personnel to report suspected abuse, mistreatment, neglect, or property misappropriation and establishes investigation, hearing, penalty, and anti-retaliation provisions.
Why it matters
Families need a clear statutory anchor for resident rights, grievances, ombudsman access, abuse-reporting duties, and retaliation protections before deciding whether a quality concern is a complaint, an ombudsman issue, or an emergency.
28

Maryland Alzheimer's Disease and Related Dementias state plan

Guidance2022-2026 ADRD plan activeLive · Implementingofficial · new

Maryland's 2022-2026 ADRD state plan sets goals for awareness, early detection, care coordination, family caregiver support, research, and dementia data capacity.

What changes for caregivers
Maryland's ADRD plan remains in its 2022-2026 implementation window and explicitly includes expanding supports for family caregivers as a core goal.
Why it matters
For caregivers, dementia policy becomes real through diagnosis pathways, care coordination, respite and support programs, and public-health resources that reduce family burden.
29

New Jersey Medicaid home care services regulation

RegulationN.J.A.C. 10:60 readopted effective September 6, 2022Live · Effectiveofficial · new

N.J.A.C. 10:60 sets New Jersey Medicaid/NJ FamilyCare rules for home care services, including home health, personal care assistant services, waiver programs, and MLTSS.

What changes for caregivers
N.J.A.C. 10:60 explains the rules for New Jersey fee-for-service home care services and includes home health services, personal care assistant services, 1915(c) waiver programs, and MLTSS under the New Jersey 1115 Comprehensive Medicaid Waiver.
Why it matters
The regulation is the state rule anchor behind Medicaid home-care service administration. It should be paired with current MLTSS/PPP guidance before giving caregiver-facing navigation help.
30

New York expedited Medicaid fair hearings

EnforcementOTDA expedited Medicaid hearing process effective September 16, 2022Live · Effectiveofficial · new

New York OTDA maintains an expedited Medicaid fair-hearing process for cases where ordinary timing could jeopardize an appellant's life, health, or ability to attain, maintain, or regain maximum function.

What changes for caregivers
OTDA guidance explains how expedited Medical Assistance fair-hearing requests are processed, including evidence from family members or other people with personal knowledge, oral scheduling, written notices, and shortened final administrative-action windows for eligibility, nursing-facility, PASARR, services, benefits, and managed-care plan-level appeal matters.
Why it matters
When a Medicaid denial, service reduction, or coverage delay creates immediate health or function risk, caregivers may need to help document urgency and use the expedited hearing route instead of waiting for ordinary appeal timing.
31

Federal National Strategy to Support Family Caregivers

GuidancePublic comment period closed November 30, 2022Pending · Activeofficial · new

ACL's National Strategy to Support Family Caregivers is the federal roadmap for recognizing, assisting, including, supporting, and engaging family and kinship caregivers.

What changes for caregivers
ACL made the 2022 National Strategy to Support Family Caregivers available under the RAISE Family Caregivers Act and Supporting Grandparents Raising Grandchildren Act process. The Federal Register notice describes the strategy as a national roadmap with nearly 350 federal actions and more than 150 actions for other levels of government and the private sector.
Why it matters
The strategy is the federal organizing layer behind caregiver-support policy: it helps connect respite, outreach, service navigation, workplace support, caregiver assessment, and cross-agency implementation work.
32

Washington Dementia Action Collaborative state plan

Guidance2023-2028 state plan activeLive · Implementingofficial · new

Washington's Dementia Action Collaborative updated the state plan for Alzheimer's disease and other dementias for the 2023-2028 period.

What changes for caregivers
Washington's updated dementia plan sets goals, strategies, and recommendations for public and private partners preparing for growth in the population living with dementia.
Why it matters
Dementia plans shape caregiver supports, diagnosis pathways, community services, workforce planning, and partner priorities even when they are not a single benefits rule.
33

FTC health-app privacy enforcement

EnforcementFTC GoodRx action February 1, 2023; FTC/HHS warning letters July 20, 2023Live · Effectiveofficial · new

FTC enforcement actions and FTC/HHS warning letters put digital health companies, telehealth providers, and hospital systems on notice that sharing sensitive health information through advertising or tracking technologies can trigger federal consumer-protection and breach-notification enforcement.

What changes for caregivers
FTC took its first Health Breach Notification Rule enforcement action against GoodRx for alleged unauthorized health-data disclosures and later joined HHS OCR in warning hospital systems and telehealth providers about online tracking technologies that may disclose sensitive health information.
Why it matters
Caregiver-facing tools can collect medication, diagnosis, appointment, and household context; these federal enforcement signals define privacy hazards that product and partner reviews need to catch before data reaches ad or tracking vendors.
34

Alaska SB 57 host-home medical assistance legislation

LegislationChapter 22 SLA 2023 status dated July 29, 2023Passed · Signedofficial · new

Alaska SB 57 became Chapter 22 SLA 2023 and created a statutory path for host-home care services under medical assistance, including adult HCBS waiver participants and transition from foster care to host-care settings.

What changes for caregivers
The Alaska Legislature's SB 57 record lists the bill as Chapter 22 SLA 2023. The enrolled text adds AS 47.07.048 for host-home care services, ties eligibility to medical assistance and HCBS waiver participation, requires a host-care-home license, and directs the Department of Health to adopt regulations and submit state-plan, 1915(c) waiver, or 1115 demonstration amendments as necessary.
Why it matters
This is a state-law benefits-and-coverage anchor for a caregiver-relevant home setting, but operational advice still depends on Department of Health regulations, waiver approvals, and program instructions.
35

New York LHCSA minimum standards regulation

Regulation10 NYCRR Part 766 effective October 4, 2023Live · Effectiveofficial · new

10 NYCRR Part 766 sets minimum standards for licensed home care services agencies, including patient rights, service policies, plans of care, clinical supervision, personnel, and records.

What changes for caregivers
The current NYCRR Part 766 page lists Licensed Home Care Services Agencies--Minimum Standards and links to sections on patient rights, service policies and procedures, plan of care, medical orders, clinical supervision, governing authority, contracts, personnel, records, and reports.
Why it matters
Part 766 is the regulation anchor for many caregiver-facing home-care quality and documentation questions, but it should be paired with current agency guidance before being used for practical navigation.
36

New York hospice patient and family care regulation

RegulationPart 794 effective October 4, 2023; Section 793.4 effective August 31, 2016Live · Effectiveofficial · new

New York hospice regulations set patient/family care, interdisciplinary plan-of-care, caregiver education, organization, records, and reporting requirements for approved hospices.

What changes for caregivers
10 NYCRR Section 793.4 requires an interdisciplinary group, individualized written plans of care, primary-caregiver education and training, regular plan review, and communication across hospice and non-hospice providers. Part 794 identifies hospice organization and administration rules, including records and reports available to the Department upon request.
Why it matters
Family caregivers experience hospice regulation through the plan of care, caregiver training, medication instructions, records, and provider coordination. This row gives New York a state regulatory anchor in addition to federal hospice Conditions of Participation.
37

HHS OCR HIPAA online tracking guidance

GuidanceOCR tracking-technology guidance activeLive · Effectiveofficial · new

HHS OCR guidance explains how HIPAA applies when covered entities and business associates use tracking technologies on websites or mobile apps that collect or disclose protected health information.

What changes for caregivers
HHS OCR explains that regulated entities may not use tracking technologies in ways that impermissibly disclose PHI to tracking technology vendors and describes HIPAA compliance obligations for authenticated pages, unauthenticated pages, and mobile apps.
Why it matters
Caregivers often interact with portals, intake forms, telehealth sites, and care apps; tracking choices can turn private care context into a compliance and trust problem.
38

New Jersey hospice licensing standards regulation

RegulationN.J.A.C. 8:42C readopted February 15, 2024; technical changes March 18, 2024Live · Effectiveofficial · new

New Jersey readopted N.J.A.C. 8:42C Hospice Licensing Standards, which set state licensing and operating standards for outpatient and inpatient hospices.

What changes for caregivers
NJDOH's 2024 readoption notice says N.J.A.C. 8:42C Hospice Licensing Standards establishes uniform standards for licensure and operation of outpatient and inpatient hospices in New Jersey, including licensure procedures, patient rights, patient care services, nursing, pharmacy, medical records, infection prevention, and inpatient hospice unit standards.
Why it matters
Hospice quality questions in New Jersey need a state regulatory anchor in addition to federal Medicare hospice rules, especially when families are comparing provider duties, patient rights, and complaint routes.
39

Washington My Health My Data Act

LegislationSigned April 27, 2023; compliance activeLive · Effectiveofficial · new

Washington's My Health My Data Act protects consumer health data beyond traditional HIPAA settings and is a leading state model for care-adjacent privacy rights.

What changes for caregivers
Washington created broad rights and obligations around consumer health data, including data collected by apps and services outside traditional covered-entity healthcare.
Why it matters
Caregiver tools can collect sensitive data about symptoms, location, household needs, and family relationships; Washington is a key model for non-HIPAA health-data governance.
40

Washington My Health My Data Act

LegislationEffective 2024-03-31Live · Effectiveofficial · updated

Consumer health data regime relevant to non-HIPAA health, mental health, and caregiving applications.

What changes for caregivers
Consumer health data regime relevant to non-HIPAA health, mental health, and caregiving applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
41

Nevada SB 370 consumer health data law

LegislationEffective 2024-03-31Live · Effectiveofficial · updated

Consumer health data law relevant to non-HIPAA mental health and caregiving applications.

What changes for caregivers
Consumer health data law relevant to non-HIPAA mental health and caregiving applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
42

New Jersey Domestic Workers' Bill of Rights in home care

ImplementationEffective July 1, 2024; rulemaking implementation ongoingLive · Effectiveofficial · updated

New Jersey's Domestic Workers' Bill of Rights applies workplace protections to many in-home care and household workers, including workers caring for older or disabled people in private homes.

What changes for caregivers
New Jersey extended wage, notice, anti-retaliation, and working-condition protections to covered domestic workers, including many workers providing care in private homes.
Why it matters
Caregivers who hire or coordinate paid help at home need to understand worker-rights obligations because home-care continuity depends on a lawful, stable workforce.
43

CMS GUIDE dementia caregiver model implementation

ImplementationEight-year model began July 1, 2024Live · Implementingofficial · updated

CMS is implementing the GUIDE Model for dementia care, including care navigation, caregiver training, 24/7 support lines, and respite services for eligible participants.

What changes for caregivers
CMS launched an eight-year dementia care model that pays participating organizations for comprehensive care management, caregiver support, 24/7 access, and respite for eligible beneficiaries.
Why it matters
Dementia caregiver burden is shaped by navigation, crisis support, and respite availability, not only by medical visits.
44

HHS Section 504 health-care disability rule

RegulationFinal rule effective July 8, 2024Live · Effectiveofficial · updated

HHS finalized updated Section 504 rules for HHS-funded health programs, including disability nondiscrimination protections for medical treatment decisions and accessible health services.

What changes for caregivers
HHS updated Section 504 rules for recipients of HHS funding, including protections against disability-based bias in medical treatment decisions and requirements around accessible services, communication, and program access.
Why it matters
Caregivers often become the practical advocate when disability bias, inaccessible communication, or representative access blocks care.
45

New York hospital cybersecurity regulation

Regulation10 NYCRR 405.46 effective on State Register adoption October 2, 2024Live · Effectiveofficial · new

New York adopted 10 NYCRR 405.46 to require licensed general hospitals to maintain cybersecurity programs covering hospital information systems, PHI, PII, access controls, risk assessments, incident response, and reporting.

What changes for caregivers
The adopted rule added 10 NYCRR 405.46 for New York general hospitals. The official regulation text applies to all general hospitals, defines cybersecurity events and incidents, includes PHI and biometric data in nonpublic-information concepts, and requires cybersecurity programs, policies, risk assessments, access controls, incident response, and Department reporting.
Why it matters
Hospital outages, ransomware, and record-system disruptions can directly shift coordination and safety burden onto family caregivers. This row is the New York regulatory anchor for hospital cyber resilience and patient-data protection.
46

Pennsylvania Alzheimer's, Dementia and Related Disorders Office

ImplementationADRD Office created by Act 111 of 2024Live · Implementingofficial plus tracker · new

Pennsylvania created an Alzheimer's, Dementia and Related Disorders Office within the Department of Aging to coordinate dementia policy and planning.

What changes for caregivers
Pennsylvania established a dedicated ADRD Office under the Department of Aging, with oversight responsibilities and a role in updating the state's dementia plan.
Why it matters
A dedicated state dementia office can shape caregiver supports, public health messaging, care coordination, and advocacy priorities for families affected by dementia.
47

BOLD dementia public-health infrastructure reauthorized

LegislationAuthorized for FY2025-FY2029Live · Effectiveofficial · updated

Federal law reauthorized BOLD dementia public-health infrastructure, which supports state and local dementia risk reduction, early detection, and caregiving programs.

What changes for caregivers
Public Law 118-142 extends the federal BOLD dementia infrastructure program that CDC frames around risk reduction, early detection, avoidable hospitalization prevention, and dementia caregiving.
Why it matters
This is not a direct family entitlement, but it shapes state and local dementia education, data, and caregiver-support infrastructure.
48

New Jersey Alzheimer's Adult Day Services subsidy

Implementation2025 financial guidelines postedLive · Effectiveofficial · new

New Jersey subsidizes adult day services for people with Alzheimer's disease or related dementia who live in the community and have an uncompensated caregiver.

What changes for caregivers
The state program subsidizes participating adult day services and defines eligibility around dementia diagnosis, community residence, caregiver support, and income/assets.
Why it matters
Dementia caregiving often hinges on daytime supervision and respite; eligibility, cost share, and conflicts with other programs need plain comparison for families.
49

California Paid Family Leave caregiver wage replacement

ImplementationBenefit enhancement began January 1, 2025Live · Effectiveofficial · new

California Paid Family Leave provides short-term wage replacement when workers take time off to care for a seriously ill family member.

What changes for caregivers
California's Paid Family Leave program is an active caregiver-support model, and 2025 changes increased wage replacement levels for new claims.
Why it matters
Caregivers often cannot use leave if wage replacement is too low; California is a benchmark state for explaining paid-caregiving leave and income tradeoffs.
50

California AB 3030 healthcare GenAI communication disclosure

LegislationEffective 2025-01-01Live · Effectiveofficial · updated

Requires health facilities and clinics to include a GenAI disclaimer for patient health-status communications unless reviewed by a licensed or certified provider.

What changes for caregivers
Requires health facilities and clinics to include a GenAI disclaimer for patient health-status communications unless reviewed by a licensed or certified provider.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
51

Elizabeth Dole Act caregiver and home-care implementation

ImplementationImplementation active after January 2, 2025 enactmentLive · Implementingofficial · updated

VA is implementing the Elizabeth Dole Act, a broad veterans package with caregiver, home-care, benefits, and access provisions.

What changes for caregivers
VA describes the law as addressing healthcare, economic opportunities, support for caregivers, and veteran homelessness, with multiple implementation workstreams.
Why it matters
Veteran caregivers need to know which provisions are live, which are still being implemented, and where VA navigation changes affect real access.
52

New Jersey Data Privacy Law in effect

ImplementationEffective January 15, 2025Live · Effectiveofficial · updated

New Jersey's comprehensive data privacy law is in effect and gives residents rights to access, correct, delete, and opt out of certain personal-data uses.

What changes for caregivers
New Jersey's privacy law is active, with consumer rights and controller obligations that can apply to care-adjacent digital services handling residents' personal data.
Why it matters
Caregiver support tools may hold sensitive household, health, location, or care-context data; New Jersey users need clear privacy rights and operational response paths.
53

New Jersey Data Privacy Law statutory authority

LegislationNew Jersey Data Privacy Law effective January 15, 2025Live · Effectiveofficial · new

New Jersey's Data Privacy Law is the statutory authority behind state consumer rights to access, correct, delete, obtain, and opt out of certain personal-data uses, including sensitive care-adjacent data handled by digital services.

What changes for caregivers
P.L.2023, c.266 supplemented Title 56 to create New Jersey consumer personal-data rights and controller obligations. The official enrolled law includes Division of Consumer Affairs access to data protection assessments, while the Division FAQ identifies the law as the New Jersey Data Privacy Law and states that it guarantees New Jersey consumers rights regarding their personal data.
Why it matters
Caregiver-facing tools can hold personal, household, health-adjacent, location, and support-needs data. The statutory row gives the legal-authority anchor separate from the existing implementation and proposed-regulation rows.
54

New Jersey Data Privacy Law consumer guidance

GuidanceDivision FAQ describes the law in effect January 15, 2025Pending · Activeofficial · new

The New Jersey Division of Consumer Affairs maintains public FAQ guidance explaining the state's Data Privacy Law, including consumer rights, controller obligations, and enforcement basics.

What changes for caregivers
The Division of Consumer Affairs FAQ is the state's public guidance layer for P.L.2023, c.266. It describes the NJDPL as guaranteeing New Jersey consumers rights with regard to personal data and explains how residents and regulated entities should understand the law at a high level.
Why it matters
Caregivers and care recipients are more likely to encounter an agency FAQ than enrolled bill text when they need to understand access, deletion, correction, or opt-out rights around care-adjacent digital services.
55

New Jersey palliative, hospice, and POLST guidance

GuidancePalliative and hospice guidance last reviewed March 11, 2024; POLST page last reviewed January 21, 2025Pending · Activeofficial · new

New Jersey Department of Health publishes official guidance on palliative care, hospice care, and POLST orders for life-sustaining treatment.

What changes for caregivers
NJDOH's palliative and hospice page describes palliative care as patient- and family-centered care across the continuum of illness and hospice as comfort-focused support for terminal illness, usually at home, with family caregiver support. NJDOH's POLST page explains that the form records life-sustaining-treatment preferences and follows the patient across settings.
Why it matters
Caregivers often need to distinguish palliative care, hospice, POLST, and advance directives before a crisis admission or discharge. This row gives the corpus an official New Jersey guidance anchor without turning it into medical or legal advice.
56

New York genetic testing insurance-protection proposal

LegislationActive in Assembly Insurance CommitteePending · Activeofficial · new

New York A3229A would restrict insurers from using genetic testing or genetic predisposition in coverage and rate decisions.

What changes for caregivers
A3229A, the Dennis Crawley genetic protection act of New York, would prohibit specified insurers from conditioning rates, coverage, renewal, or other coverage terms on genetic testing or genetic predisposition.
Why it matters
For ALS and other inherited-risk families, fear that genetic testing could affect insurance can shape care planning, privacy decisions, and whether relatives pursue useful information.
57

New York regional home-care reimbursement proposal

Legislation2025-2026 session; in Senate HealthProposed · Proposedofficial · updated

New York S3599 would require DOH to set regional minimum hourly base reimbursement rates for home-care providers employing home-care and personal-care aides.

What changes for caregivers
The bill would direct DOH to establish and publish regional minimum hourly base reimbursement rates and seek CMS approval for state-directed payments where applicable.
Why it matters
Payment-rate uncertainty can affect provider contracting, worker retention, and whether consumers can actually staff authorized home-care hours.
58

Florida SMMC Long-Term Care program

ImplementationSMMC 3.0 contracts implemented February 1, 2025Live · Effectiveofficial · new

Florida's Statewide Medicaid Managed Care Long-Term Care program provides managed long-term care services for eligible people who need nursing-facility-level care.

What changes for caregivers
Florida implemented the SMMC 3.0 contract cycle and continues to administer Long-Term Care program enrollment, plan selection, and coverage policy through AHCA.
Why it matters
For families, the practical work is understanding eligibility, plan choice, welcome letters, provider networks, and how long-term care services are coordinated.
59

Michigan Earned Sick Time Act caregiving use

ImplementationEarned Sick Time Act effective February 21, 2025Live · Effectiveofficial · new

Michigan's Earned Sick Time Act went into effect February 21, 2025 and changed state earned sick time rules for workers and employers.

What changes for caregivers
Michigan's earned sick time framework changed in 2025, expanding the state leave-rights landscape workers use for their own or family-related health needs.
Why it matters
Even when leave is not a full paid-family-leave program, earned sick time can be the practical tool caregivers use for appointments, acute care episodes, and short-notice family health needs.
60

Protecting Rural Seniors' Access to Care Act

LegislationIntroduced and referred February 27, 2025Proposed · Proposedofficial · new

H.R. 1683, introduced in the House on February 27, 2025, would prohibit HHS from implementing or enforcing the 2024 federal nursing-home staffing rule and would establish an advisory panel on the nursing-home workforce.

What changes for caregivers
The introduced House bill would bar HHS from implementing, enforcing, or giving effect to the May 10, 2024 federal minimum-staffing final rule for long-term care facilities and would create a 17-member advisory panel on nursing-home workforce issues.
Why it matters
This is a live legislative counterweight to federal nursing-home staffing policy, but it is not current law; families need the distinction between proposed congressional action, CMS rules, state staffing standards, and facility-specific quality signals.
61

DOL FMLA family-caregiver enforcement resources

EnforcementWHD caregiver FMLA resources active; Fact Sheet #28P updated March 2025Pending · Activeofficial · new

The U.S. Department of Labor Wage and Hour Division maintains caregiver-specific FMLA resources and complaint pathways for workers using job-protected leave to care for family members.

What changes for caregivers
DOL's Wage and Hour Division maintains family-caregiver FMLA materials that explain job-protected leave for workers caring for family members and route workers to WHD if they have questions or believe their FMLA rights were violated.
Why it matters
For working caregivers, FMLA enforcement is the federal backstop for preserving employment while taking unpaid, job-protected time to provide family or military caregiving.
62

Credit for Caring Act caregiver tax-credit proposal

Legislation119th CongressPending · Activeofficial plus tracker · updated

The bipartisan Credit for Caring Act would create a federal tax credit for eligible working family caregivers.

What changes for caregivers
The proposal would offset some caregiving expenses such as home care aides, adult day services, home modifications, transportation, and respite.
Why it matters
Caregivers often absorb out-of-pocket costs while reducing work hours; tax policy is one route for direct economic support.
63

New Jersey Family Leave Insurance caregiving guidance

GuidanceNJDOL Job Protection Checker announced March 13, 2025Pending · Activeofficial · new

New Jersey Department of Labor guidance explains caregiving Family Leave Insurance benefits, covered relationships, documentation, provider certification, application paths, and the separate job-protection question.

What changes for caregivers
NJDOL's FLI worker page defines caregiving broadly, lists expanded family-member relationships, explains that caregiving claims need worker and health-care-provider documentation, and sends workers to a job-protection checker because wage replacement and job protection are separate.
Why it matters
The guidance is the practical intake layer for New Jersey caregivers who need pay replacement while coordinating a loved one's care and medical certification.
64

ABC Act caregiver administrative-burden proposal

Legislation119th CongressPending · Activeofficial · updated

The ABC Act would require CMS and SSA to review and simplify forms, processes, and communications that family caregivers use to navigate major federal benefit programs.

What changes for caregivers
H.R.2491 and S.1227 would require CMS and SSA to simplify forms, processes, and communications for family caregivers helping people use Medicare, Medicaid, CHIP, and Social Security programs.
Why it matters
This targets paperwork friction rather than benefit expansion, making it a strong row for navigation burden and caregiver time.
65

Maryland advance directive and health care agent authority

LegislationAdvance directive authority activeLive · Effectiveofficial · new

Maryland's Health Care Decisions Act allows people to use an advance directive to name a health care agent and record treatment preferences.

What changes for caregivers
Maryland maintains an official advance directive form and guidance for appointing a health care agent and stating life-sustaining treatment preferences.
Why it matters
Families need these documents before a crisis because caregiver status alone may not create medical decision-making authority.
66

New Jersey nursing-home resident rights legislation

LegislationNJLTCO nursing-home bill-of-rights page updated May 15, 2025Live · Effectiveofficial · new

New Jersey's nursing-home resident-rights law and Ombudsman materials identify protected rights around dignity, care planning, privacy, complaints, finances, visits, and safe living conditions.

What changes for caregivers
N.J.S.A. 30:13-5 sets rights of nursing-home residents, and NJLTCO's public bill-of-rights page translates those rights into caregiver-relevant topics such as care planning, physical environment, dignity, finances, communication, complaints, and protection from reprisal.
Why it matters
Families need an official rights anchor before deciding whether a long-term-care concern should go through the facility, NJDOH, LTCO, a resident council, or emergency channels.
67

New Jersey health-facility complaint and quality guidance

GuidanceComplaint guidance last reviewed May 16, 2025Live · Effectiveofficial · new

New Jersey DOH explains how patients, residents, facility staff, caregivers, and the public can file complaints about licensed healthcare facilities, including nursing homes, assisted living, home health agencies, adult medical day care, and hospitals.

What changes for caregivers
NJDOH's health-facilities pages identify the 24-hour complaint hotline, online complaint submission, complaint categories such as abuse, neglect, exploitation, facility emergencies, and the agency's quality-of-care regulation, survey, complaint-investigation, and non-compliance penalty role.
Why it matters
When facility quality concerns become caregiver work, families need a state complaint route that is separate from a facility's own customer-service channel and linked to licensed-facility oversight.
68

New Jersey health-care facility complaint and enforcement route

EnforcementNJDOH complaint page last reviewed May 16, 2025Pending · Activeofficial · new

NJDOH accepts complaints about hospitals and other licensed health-care facilities and describes how complaints, surveys, deficiencies, plans of correction, fines, and other enforcement remedies work.

What changes for caregivers
NJDOH's complaint page says patients, health-care facility employees, and members of the public may file complaints about hospitals, home health agencies, nursing homes, assisted living facilities, and other licensed facilities. NJDOH's enforcement page explains that complaints may be investigated by inspection, interviews, and record review; deficiencies can be cited; and remedies can include plans of correction, fines, admission curtailment, conditional licenses, suspension, revocation, or other remedies.
Why it matters
When a caregiver cannot resolve a discharge, patient-rights, facility-quality, or access problem inside a hospital or licensed facility, the state complaint and enforcement route is the next official pathway.
69

Federal ALS Registry funding protection push

BudgetFY2026 appropriations watch itemPending · Activeofficial · new

Members of Congress urged appropriators to protect and expand funding tied to ALS research and the National ALS Registry.

What changes for caregivers
A bipartisan congressional effort asked appropriators to support ALS research funding and protect the National ALS Registry; the CDC registry remains the federal surveillance and research infrastructure to watch.
Why it matters
ALS families and advocates depend on registry and research infrastructure for prevalence data, study recruitment, and service-planning visibility, but this row does not claim any funding level was enacted.
70

NJ FamilyCare eligibility and managed-care regulations

RegulationAdministrative Code files current through June 16, 2025Live · Effectiveofficial · new

New Jersey Administrative Code chapters for NJ FamilyCare and Medicaid/NJ FamilyCare managed-care services define eligibility, redetermination, service-package, cost-sharing, and managed-care enrollment rules that shape benefits access.

What changes for caregivers
NJAC 10:78 sets NJ FamilyCare eligibility and redetermination rules, including 12-month redetermination timing, service-package references, and cost-sharing provisions; NJAC 10:74 sets managed-care enrollment rules for Medicaid/NJ FamilyCare beneficiaries.
Why it matters
Caregivers navigating Medicaid coverage need to separate renewal guidance, managed-care plan operations, and the underlying regulatory rules that determine when coverage or plan enrollment can change.
71

New Jersey Alzheimer's Adult Day Services regulation

RegulationN.J.A.C. 10:164A current through June 16, 2025; chapter expires July 8, 2028Live · Effectiveofficial · new

New Jersey Administrative Code Chapter 10:164A governs the Adult Day Services Program for Persons with Alzheimer's Disease or Related Disorders, including purpose, scope, target population, eligibility, payment, and appeals provisions.

What changes for caregivers
N.J.A.C. 10:164A states that DHS intends the Adult Day Services Program for Persons with Alzheimer's Disease or Related Disorders to provide relief and support to family caregivers through subsidized adult day services. The chapter applies to social adult day agencies and adult day health services facilities operating under a Department letter of agreement, limits the target population to people with Alzheimer's disease or related dementia, and includes eligibility and appeals provisions.
Why it matters
The regulation is the operating rule layer behind New Jersey's Alzheimer's adult day subsidy row, and it makes caregiver relief an explicit program purpose.
72

New Jersey nursing-home staffing reporting and enforcement

EnforcementEnforcement active; OSC action posted June 19, 2025Live · Effectiveofficial · updated

New Jersey's nursing-home staffing-ratio law is paired with public staffing reports and Medicaid enforcement activity for serious staffing-violation cases.

What changes for caregivers
New Jersey's nursing-home staffing-ratio law remains paired with DOH public staffing reports, and the State Comptroller has used Medicaid recovery and payment withholding in serious staffing-violation cases.
Why it matters
For families, staffing ratios are not just a policy slogan; New Jersey has official public reports and an enforcement path that can affect facilities receiving Medicaid funds.
73

Nevada AB 406 AI restrictions in mental and behavioral health

LegislationEffective 2025-06-29Live · Effectiveofficial · updated

Restricts AI systems programmed to provide professional mental or behavioral health care, including marketing and direct care interactions.

What changes for caregivers
Restricts AI systems programmed to provide professional mental or behavioral health care, including marketing and direct care interactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
74

New York nursing-home enforcement actions

EnforcementEnforcement reporting period through June 30, 2025Live · Effectiveofficial · new

NYS Health Profiles publishes a searchable nursing-home enforcement-actions view and explains how state fines relate to survey citations and noncompliance.

What changes for caregivers
NYS Health Profiles lists nursing homes with enforcement actions and its methodology explains that Public Health Law section 12 allows DOH to assess fines when cited noncompliance resulted in harm, substandard quality of care, or immediate risk for harm.
Why it matters
Caregivers comparing facilities need to know that citations, enforcement actions, fines, and correction dates are separate signals and should be checked alongside inspection and complaint history.
75

ACL caregiver strategy state implementation NOFO

ImplementationFY2025 NOFO posted June 17, 2025; projects expected to start July 1, 2025Live · Implementingofficial · new

ACL's FY2025 cooperative-agreement opportunity funds state units on aging to implement parts of the 2022 National Strategy to Support Family Caregivers through cross-agency state partnerships.

What changes for caregivers
ACL posted a Grants.gov NOFO for Advancing State Implementation of the National Strategy to Support Family Caregivers. The synopsis says grantees use the 2022 strategy as the framework, develop state-level cross-agency partnerships, complete an initial planning period of up to six months, submit a sustainability plan, and then focus on implementation and execution during two-year projects.
Why it matters
This is the federal implementation bridge from national caregiver-strategy recommendations into state-level caregiver-support systems, especially through state units on aging and Title III-E infrastructure.
76

New Jersey Data Privacy Act proposed regulations

RegulationProposed N.J.A.C. 13:45L comments due August 1, 2025Pending · Activeofficial · new

New Jersey proposed N.J.A.C. 13:45L rules to implement the New Jersey Data Privacy Act, including controller, processor, consumer-rights, opt-out, exemption, and AI-training consent details.

What changes for caregivers
The Division of Consumer Affairs proposed N.J.A.C. 13:45L to implement P.L. 2023, c. 266, the New Jersey Data Privacy Act, including definitions, exemptions, consumer-rights notices, universal opt-out mechanisms, and limits around using internal-research data to train artificial intelligence without affirmative consent.
Why it matters
Caregiver-facing tools can hold personal, household, health-adjacent, location, and support-needs data; the proposed rules are the regulatory layer beneath New Jersey privacy-rights operations.
77

Illinois WOPR Act - HB 1806

LegislationEffective 2025-08-01Live · Effectiveofficial · updated

Restricts AI in therapy and psychotherapy, reserves therapeutic services for licensed professionals, and creates civil penalties.

What changes for caregivers
Restricts AI in therapy and psychotherapy, reserves therapeutic services for licensed professionals, and creates civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
78

New Jersey end-of-life complaint and MAID compliance routes

EnforcementMAID page last reviewed August 5, 2025; facility complaint guidance last reviewed June 2, 2023Pending · Activeofficial · new

New Jersey routes hospice-center complaints through the Department of Health and requires Medical Aid in Dying compliance forms and dispensing records to be filed with the Department.

What changes for caregivers
NJDOH states that MAID compliance forms and medication dispensing records must be filed with the Department of Health through the Office of the Chief State Medical Examiner. NJDOH also identifies hospice centers as facilities under Department jurisdiction for official care complaints, with an online complaint form and 24-hour complaint hotline.
Why it matters
End-of-life care raises both quality-of-care and legal-process questions. Families and providers need separate routes for hospice complaints, MAID documentation, and Medicare-affiliated grievances without treating GiveCare as an adjudicator.
79

CMS Medicaid and CHIP status-verification oversight

EnforcementMonthly state reports and monitoring began August 19, 2025Live · Implementingofficial · new

CMS launched a Medicaid and CHIP oversight initiative that sends states monthly reports for enrollees whose citizenship or immigration status could not be confirmed through federal databases.

What changes for caregivers
CMS says it began providing states with monthly enrollment reports identifying Medicaid and CHIP enrollees whose citizenship or immigration status could not be confirmed through federal databases, with states responsible for reviewing cases, requesting documentation when needed, and taking appropriate coverage or eligibility actions.
Why it matters
Eligibility-verification notices can become urgent caregiver paperwork; families may need to distinguish a documentation request from a final coverage decision and use official state Medicaid or appeal channels when coverage is at risk.
80

New Jersey long-term-care Medicaid bed access implementation

ImplementationDOH memorandum dated August 19, 2025Live · Effectiveofficial · new

New Jersey DOH issued implementation guidance to Medicaid-certified long-term care facilities on Medicaid bed-ratio utilization requirements, admission obligations, change-in-payer-source protections, and possible enforcement remedies.

What changes for caregivers
NJDOH reminded Medicaid-certified long-term care facilities that they must maintain compliance with certificate-of-need and licensure regulations, including Medicaid bed-ratio utilization requirements, admission/waiting-list obligations for Medicaid-eligible individuals, and limits on discharging residents solely because of a change in payer source.
Why it matters
Facility admission and payer-source disputes can leave families searching for placement or fighting discharge pressure; this memo gives an official implementation hook for access-to-care questions.
81

New York CDPAP single fiscal intermediary implementation

ImplementationImplementation activeLive · Implementingofficial · updated

New York continues implementation of Consumer Directed Personal Assistance Program changes that affect how consumers and personal assistants register, document, and get paid.

What changes for caregivers
CDPAP administrative rules and transition materials changed the pathway for consumer-directed home care and personal assistant enrollment.
Why it matters
A registration, payroll, or documentation failure can disrupt care at home even when the underlying service need has not changed.
82

CMS hospital discharge-planning survey guidance

GuidanceCMS QSO memo dated September 5, 2025Live · Effectiveofficial · updated

CMS revised hospital survey guidance for discharge planning, including guidance relevant to caregiver or support-person involvement and safe post-discharge transitions.

What changes for caregivers
CMS revised State Operations Manual Appendix A guidance for hospital surveyors, including discharge-planning interpretive guidance that references caregiver or support-person involvement and safe post-discharge transitions.
Why it matters
Unsafe discharge is a recurring caregiver burden; this gives a source-backed accountability hook for explaining what hospitals are expected to document and discuss.
83

Federal FAMILY Act paid-leave proposal

Legislation119th CongressPending · Activeofficial · updated

The FAMILY Act would create federal paid family and medical leave benefits, including leave to care for a qualified family member with a serious health condition.

What changes for caregivers
H.R.5390 and S.2823 would establish a national paid family and medical leave insurance benefit, including caregiving leave for a qualified family member.
Why it matters
Direct national wage replacement would be material for working caregivers, but this is proposed only and should be compared with state leave programs.
84

Medicare hospice HOPE assessment implementation

ImplementationHOPE replaced HIS beginning October 1, 2025Live · Implementingofficial · updated

CMS moved Medicare hospice quality reporting from the Hospice Item Set to the HOPE patient assessment workflow for relevant admissions, update visits, and discharges.

What changes for caregivers
CMS moved Medicare hospice quality reporting from HIS to the HOPE patient assessment workflow for relevant hospice admissions, update visits, and discharges.
Why it matters
Hospices now have new documentation and submission workflows that may affect care-plan timing, quality reporting, and administrative load around hospice care.
85

New York hospital cybersecurity implementation schedule

ImplementationGeneral hospital compliance due October 2, 2025; 72-hour incident reporting effective at adoptionLive · Effectiveofficial · new

New York hospitals had one year from adoption of 10 NYCRR 405.46 to comply with most cybersecurity-program requirements, while cybersecurity-incident reporting became effective at adoption.

What changes for caregivers
The adopted regulation's compliance schedule gave general hospitals one year from the October 2, 2024 effective date to comply with most new requirements, while subdivision 405.46(n) requires hospitals to notify the Department as promptly as possible and no later than 72 hours after determining that a cybersecurity incident occurred.
Why it matters
The implementation date matters for evaluating current hospital cyber-readiness claims and for building caregiver scenarios around downtime, access delays, and hospital communications after an incident.
86

Washington palliative care benefit work group

GuidanceFinal report due November 1, 2025Live · Implementingofficial · new

Washington directed the Insurance Commissioner and Health Care Authority to design parameters for a palliative care benefit for fully insured health plans and report recommendations to the Legislature.

What changes for caregivers
Washington's palliative care benefit work group moved serious-illness benefit design into a formal legislative reporting process.
Why it matters
Benefit design determines whether families can access palliative care without impossible coverage, referral, or payment barriers.
87

New York General Business Law Article 47, section 1700

LegislationEffective 2025-11-05Live · Effectiveofficial · updated

Defines AI companions around sustained human-like relationships, prior-interaction memory, emotion-based questions, and personal dialogue.

What changes for caregivers
Defines AI companions around sustained human-like relationships, prior-interaction memory, emotion-based questions, and personal dialogue.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
88

New Jersey data privacy and cybersecurity enforcement route

EnforcementConsumer complaint page last modified December 16, 2025Pending · Activeofficial · new

New Jersey routes data-privacy and cybersecurity enforcement through the Attorney General, Division of Law, and Division of Consumer Affairs, with public complaint intake for consumer issues.

What changes for caregivers
New Jersey's Attorney General created a Data Privacy and Cybersecurity Section to bring civil actions enforcing data privacy and cybersecurity laws, and the Division of Consumer Affairs maintains public complaint intake. The NJDPL FAQ also says the Attorney General may go to court to stop NJDPL violations and seek relief for affected consumers.
Why it matters
When a caregiver-facing app, health-adjacent service, or data broker mishandles care-related personal data, families need an official state route without treating complaint filing as a guaranteed remedy.
89

NJ FamilyCare renewal guidance

GuidanceAnnual renewal guidance activeLive · Effectiveofficial · new

New Jersey's Stay Covered NJ guidance tells NJ FamilyCare members to update contact information, watch for renewal mail, respond on time, and use official help channels to avoid coverage gaps.

What changes for caregivers
Stay Covered NJ directs members to confirm or update contact information, watch for mail from New Jersey or county boards of social services, respond to renewal requests, seek help through NJ FamilyCare or county offices, and use fair-hearing routes when coverage is terminated.
Why it matters
Caregivers often manage renewal mail, online accounts, document requests, and calls; missing a renewal packet or follow-up letter can interrupt medications, home care, transportation, or managed-care continuity.
90

NJ FamilyCare managed-care appeals and fair hearings

EnforcementJanuary 2026 MCO contract and appeal materials activeLive · Effectiveofficial · new

New Jersey's NJ FamilyCare managed-care materials define utilization appeals, external review, Medicaid fair-hearing access for eligible members, continuation-of-benefits timing, and DMAHS follow-up when plan responses do not meet contract guidelines.

What changes for caregivers
NJ FamilyCare materials explain member and provider appeal routes for adverse utilization-management decisions, including external IURO review, Medicaid fair-hearing access for Medicaid/NJ FamilyCare A and ABP members, continuation-of-benefits timing, DMAHS Office of Managed Health Care inquiry follow-up, and potential notices of deficiency or corrective action plans.
Why it matters
A denial, reduction, suspension, or termination of a covered service can immediately shift care work to families; caregivers need to know that appeal timing and continuation-of-benefits requests are operational deadlines, not general customer-service questions.
91

New York Paid Family Leave 2026 family-care rates

Implementation2026 benefit yearLive · Effectiveofficial · updated

New York's 2026 Paid Family Leave rates set the maximum weekly benefit and employee contribution cap for workers taking family-care leave.

What changes for caregivers
NY's 2026 PFL maximum weekly benefit is $1,228.53, with an employee contribution rate of 0.432 percent capped at $411.91; family-care leave remains up to 12 weeks at 67 percent of pay up to the cap.
Why it matters
Families need wage-cap details and form timing before leave starts, especially when a care episode collides with work income.
92

New Jersey Family Leave Insurance 2026 family-care rates

Implementation2026 rates effectiveLive · Effectiveofficial · updated

New Jersey's 2026 Family Leave Insurance rates set the weekly benefit cap for workers taking paid leave to care for a seriously ill or injured loved one.

What changes for caregivers
NJ's 2026 maximum weekly TDI and FLI benefit is $1,119, and FLI eligibility uses wage or base-year earnings thresholds. FLI provides wage replacement, not job protection by itself.
Why it matters
Caregivers often confuse FLI cash benefits with FMLA or NJFLA job protection, which changes the practical next step.
93

New York Paid Family Leave family-care guidance

GuidanceCurrent 2026 PFL family-care guidancePending · Activeofficial · new

New York Paid Family Leave guidance explains family-care leave, covered family relationships, serious health condition examples, required forms, provider certification, and filing steps.

What changes for caregivers
NY's family-care page explains that Paid Family Leave can be used to care for a close family member with a serious health condition, lists covered relationships, names the PFL-1/PFL-3/PFL-4 family-care forms, and describes employer, provider, insurer, filing, and denial-dispute steps.
Why it matters
This is the official caregiver-facing workflow behind the existing 2026 rate row, and it determines what a working caregiver needs to collect before a claim can move.
94

New York Paid Family Leave retaliation and complaint enforcement

EnforcementCurrent NY PFL rights and complaint processLive · Effectiveofficial · new

New York Paid Family Leave materials describe job protection, health-insurance continuation, anti-retaliation protections, reinstatement requests, complaint forms, Board hearings, and denial arbitration.

What changes for caregivers
NY's PFL rights page describes protection from discrimination or retaliation, a formal reinstatement request, a discrimination/retaliation complaint form, and Workers' Compensation Board hearing process; employer guidance also points denied or disputed claims to arbitration.
Why it matters
The enforcement row lets caregiver support workflows distinguish a regular claim, a benefit denial dispute, and a workplace retaliation or reinstatement issue.
95

ONC HTI-1 certified health IT algorithm transparency

RegulationEffective February 8, 2024; USCDI v3 baseline January 1, 2026Live · Effectiveofficial · updated

Federal certified-health-IT rules now include transparency requirements for AI and predictive decision-support tools used in clinical software.

What changes for caregivers
The HTI-1 final rule adds transparency expectations for predictive decision-support interventions in certified health IT and moves certified products toward USCDI v3 as the baseline standard.
Why it matters
Caregivers often see downstream effects of clinical tools without knowing what influenced a recommendation; transparency requirements can shape what care teams can explain about software-supported decisions.
96

ONC HTI-1 Insights Condition implementation

ImplementationJanuary 1, 2026 certification criteria compliance dates with ONC enforcement discretionLive · Implementingofficial · new

ONC is implementing the HTI-1 Insights Condition and related certification updates, including reporting resources and temporary enforcement-discretion notices tied to January 1, 2026 certification criteria compliance dates.

What changes for caregivers
ONC's HTI-1 implementation materials identify the Insights Condition, Year 1 reporting resources, measure specifications, and enforcement-discretion notices for selected January 1, 2026 certification criteria updates after the 2025 lapse in appropriations.
Why it matters
Certified health IT affects how care plans, transitions, patient access, APIs, and decision-support information show up to clinicians, patients, and caregivers; implementation timing changes what product teams and care organizations can rely on.
97

New York Medicaid fair-hearing guidance

GuidanceOTDA fair-hearing guidance activeLive · Effectiveofficial · new

New York OTDA's fair-hearing guidance explains when Medical Assistance applicants or recipients may request a hearing, time limits, aid-continuing requests, evidence submission, representation, expedited requests, and compliance complaints.

What changes for caregivers
OTDA's public fair-hearing pages explain hearing reasons that include Medical Assistance denials, reductions, cost-share disputes, and managed-care disagreements; they also explain 60-day hearing timing for many Medical Assistance notices, aid-continuing timing, evidence submission, representation, and compliance complaints.
Why it matters
Caregivers often help interpret notices, gather documents, and request hearings; missing the difference between a standard hearing, aid continuing, expedited processing, and compliance follow-up can interrupt coverage or services.
98

California Medi-Cal renewal and coverage maintenance

ImplementationAnnual renewal guidance activeLive · Effectiveofficial · new

California's DHCS continues to direct Medi-Cal members to update information and complete renewals so they can keep coverage.

What changes for caregivers
California maintains renewal and member-action guidance for Medi-Cal coverage, including updating information, completing renewal forms when required, and responding if coverage ends.
Why it matters
A missed renewal can disrupt medications, home care, transportation, and other supports caregivers rely on even when the underlying care need has not changed.
99

California skilled-nursing staffing waiver process

ImplementationFY2025-2026 waiver process activeLive · Implementingofficial · new

California CDPH is operating skilled-nursing facility staffing waiver processes tied to direct-care service hour requirements.

What changes for caregivers
CDPH is administering waiver processes for skilled-nursing facilities seeking relief from 3.5 direct-care service hour and 2.4 CNA hour requirements under specified conditions.
Why it matters
Staffing waiver activity is a facility-accountability signal families may need to understand when evaluating quality, workforce shortages, and discharge placement options.
100

California End of Life Option Act reporting

ImplementationAnnual CDPH reporting activeLive · Effectiveofficial · new

California's End of Life Option Act remains an active medical-aid-in-dying model with physician reporting and annual CDPH reports.

What changes for caregivers
California maintains an operational medical-aid-in-dying framework, including physician-submitted forms, CDPH data collection, and annual public reporting.
Why it matters
California is a mature implementation model for families and care organizations comparing MAID safeguards, documentation, reporting, and privacy obligations.
101

Washington COPES home and community-based services waiver

ImplementationCOPES waiver listing activeLive · Effectiveofficial · new

Washington's COPES waiver provides home- and community-based services for eligible older adults and adults with disabilities who meet nursing-facility-level care rules.

What changes for caregivers
Washington's COPES waiver remains a home- and community-based services pathway covering supports such as adult day services, training, community support, equipment, meals, skilled nursing, and transportation for eligible members.
Why it matters
COPES is a practical home-care route caregivers need to understand when comparing in-home support, adult family homes, assisted living, and nursing-facility placement.
102

Washington Paid Family and Medical Leave caregiver coverage

Implementation2026 premium and program updates activeLive · Effectiveofficial · new

Washington Paid Family and Medical Leave gives eligible workers paid time off for qualifying family and medical needs, including care for a family member.

What changes for caregivers
Washington's paid-leave program remains an active caregiver-support model, with 2026 program updates and premiums shaping worker and employer planning.
Why it matters
Washington is a strong comparison state for explaining paid caregiving leave, family definitions, job protection, premiums, and the difference between leave eligibility and benefits.
103

Massachusetts Paid Family and Medical Leave caregiver coverage

Implementation2026 program guidance activeLive · Effectiveofficial · new

Massachusetts PFML lets eligible workers take paid leave to care for a family member with a serious health condition.

What changes for caregivers
Massachusetts operates a paid family and medical leave program that includes leave to care for a family member with a serious health condition.
Why it matters
Massachusetts is another mature state model for explaining caregiver wage replacement, protected leave, documentation, and family-definition differences.
104

MassHealth renewal and coverage maintenance

ImplementationAnnual renewal guidance activeLive · Effectiveofficial · new

Massachusetts tells MassHealth members to renew coverage and respond to information requests so they can stay enrolled when eligible.

What changes for caregivers
MassHealth maintains renewal workflows that may require members to check due dates, submit information, and respond to notices to keep coverage active.
Why it matters
Coverage renewal is an administrative burden that caregivers often inherit; missed forms or notices can disrupt care access even when a person remains clinically eligible.
105

Connecticut Alzheimer's disease and dementia state plan

GuidanceState plan review and update cycle activeLive · Implementingofficial plus tracker · new

Connecticut's Department of Public Health maintains an Alzheimer's disease and dementia coalition to draft, implement, review, and update the state plan.

What changes for caregivers
Connecticut's ADRD plan infrastructure brings caregivers, community organizations, clinicians, researchers, public health educators, and other partners into an implementation and update cycle.
Why it matters
Dementia state plans shape referral pathways, public health messaging, caregiver supports, and partner priorities even when they are not a single benefit program.
106

Connecticut Home Care Program for Elders

ImplementationProgram guidance activeLive · Effectiveofficial · new

Connecticut's Home Care Program for Elders helps eligible older adults stay at home instead of moving to a nursing home.

What changes for caregivers
Connecticut maintains a home-care pathway for eligible older adults who are at risk of nursing home placement and need help with critical activities such as bathing, dressing, eating, medications, and toileting.
Why it matters
For caregivers, the operational question is whether home supports can be arranged before a nursing-home move becomes the default path.
107

Connecticut Paid Leave caregiver benefits

ImplementationProgram guidance active in 2026Live · Effectiveofficial · new

Connecticut Paid Leave provides income replacement for covered workers taking leave for qualifying family or medical reasons, including caregiving.

What changes for caregivers
Connecticut operates a paid leave program that gives covered workers income replacement during qualifying family or medical leave, with separate job-protection rules under FMLA/CTFMLA.
Why it matters
Caregivers often need to understand two separate questions: whether leave is paid and whether the job is protected. Connecticut is a useful model for explaining that split.
108

Maryland Home and Community-Based Options Waiver

ImplementationCMS waiver listing activeLive · Effectiveofficial · new

Maryland's Home and Community-Based Options Waiver provides Medicaid home- and community-based services for older adults and adults with physical disabilities who meet nursing-facility-level care rules.

What changes for caregivers
Maryland's waiver remains a home- and community-based pathway that can cover services such as assisted living, case management, medical day care, respite care, family training, and nutrition supports.
Why it matters
Caregivers need a plain-language way to compare waiver eligibility, available services, and waitlist/application steps with facility-care alternatives.
109

Illinois HCBS waiver for persons who are elderly

ImplementationHCBS waiver guidance activeLive · Effectiveofficial · new

Illinois' Persons who are Elderly waiver helps eligible older adults remain in a home or community setting instead of an institution or long-term care facility.

What changes for caregivers
Illinois HFS lists the Persons who are Elderly waiver as one of the state's HCBS waivers, designed to help eligible people remain at home or in community settings instead of institutional care.
Why it matters
This is a concrete home-care pathway for caregivers comparing in-home service, adult day service, emergency response, and nursing-facility alternatives.
110

Illinois nursing-home oversight and complaint surveys

EnforcementIDPH oversight and complaint process activeLive · Effectiveofficial · new

Illinois Department of Public Health licenses and surveys nursing homes and operates a 24-hour Nursing Home Hotline for complaints.

What changes for caregivers
Illinois maintains nursing-home licensure, annual survey, complaint investigation, and hotline infrastructure through the Department of Public Health.
Why it matters
When families are worried about facility quality, the action path often runs through complaint, survey, and enforcement systems rather than only through benefits or discharge planning.
111

Illinois Paid Leave for All Workers Act

ImplementationProgram active under Illinois Department of Labor guidanceLive · Effectiveofficial · new

Illinois requires covered workers to be able to earn up to 40 hours of paid leave each year that can be used for any reason.

What changes for caregivers
Illinois' Paid Leave for All Workers Act gives covered workers a general paid-leave floor, allowing time off without requiring workers to provide a reason for the request.
Why it matters
A general paid-leave floor can still matter for caregivers because not every caregiving crisis fits formal family-leave documentation or serious-health-condition rules.
112

Oregon Paid Leave caregiver benefits

Implementation2026 contribution rate guidance activeLive · Effectiveofficial · new

Paid Leave Oregon gives eligible workers paid time off for family, medical, or safe leave, including time to care for loved ones.

What changes for caregivers
Oregon operates a paid family and medical leave program that can provide wage replacement for family, medical, and safe leave, with 2026 contribution and wage-base guidance active.
Why it matters
Caregivers need to know whether they can take paid time away from work for caregiving and how contribution, application, and leave rules differ from other states.
113

Oregon Consumer Privacy Act sensitive-data rights

LegislationConsumer privacy rights activeLive · Effectiveofficial · new

Oregon's Consumer Privacy Act gives residents rights over personal and sensitive data and requires covered businesses to limit and secure data collection.

What changes for caregivers
Oregon's privacy law gives consumers more control over personal and sensitive data and requires covered businesses to limit collection, keep data secure, and provide extra protections for children and teens.
Why it matters
Oregon extends the care-tech privacy comparison beyond Washington and Maryland, helping identify where caregiver-facing tools need consent, deletion, access, and sensitive-data handling workflows.
114

Pennsylvania Medicaid and CHIP renewal requirements

ImplementationAnnual renewal requirements activeLive · Effectiveofficial · new

Pennsylvania Medicaid and CHIP members must complete renewals and may need to provide verification documents every year to keep coverage.

What changes for caregivers
Pennsylvania DHS tells Medicaid and CHIP members that they need to complete renewals and may need verification documents each year to keep healthcare coverage.
Why it matters
Caregivers often manage renewal mail, documents, and deadlines; a missed renewal can interrupt medical care, HCBS, prescriptions, or managed-care continuity.
115

Connecticut Palliative Care Advisory Council

GuidanceBiennial advisory reporting cycle activeLive · Implementingofficial · new

Connecticut's Department of Public Health maintains a Palliative Care Advisory Council that analyzes palliative care access and advises on quality of life for people with serious or chronic illnesses.

What changes for caregivers
Connecticut's advisory council keeps palliative care access, quality-of-life policy, and care-setting coverage in an active state review cycle.
Why it matters
Serious-illness policy affects when families hear about palliative care, hospice, symptom support, and care planning before a crisis forces decisions.
116

Illinois Alzheimer's Disease state plan

Guidance2026-2029 state plan publishedLive · Implementingofficial · new

Illinois maintains an Alzheimer's Disease state plan that is revised every three years and includes all dementias, including vascular, Lewy body, and frontotemporal dementia.

What changes for caregivers
Illinois updated its ADRD planning framework for the next three-year cycle, covering diagnosis, referral, support, treatment, home- and community-based resources, and quality measures.
Why it matters
Dementia state plans shape the practical ecosystem families experience: where referrals go, what caregiver supports exist, and which agencies treat ADRD as a coordinated priority.
117

Massachusetts Alzheimer's advisory reports and state plan

GuidanceAdvisory reporting and state-plan materials activeLive · Implementingofficial · new

Massachusetts maintains public Alzheimer's advisory reports and a state plan structure for Alzheimer's disease and related dementias.

What changes for caregivers
Massachusetts keeps Alzheimer's and dementia policy visible through advisory council reports and state-plan materials published by state health and aging agencies.
Why it matters
These reports are where caregiver-support priorities, dementia-capable systems work, and implementation gaps can surface before they become programs or legislative asks.
118

Pennsylvania Caregiver Support Program

ImplementationCaregiver support program activeLive · Effectiveofficial · new

Pennsylvania's Department of Aging operates a Caregiver Support Program that offers resources and assistance to people caring for others.

What changes for caregivers
Pennsylvania maintains a statewide caregiver-support pathway through the Department of Aging and local aging network partners.
Why it matters
Caregivers need to know when respite, supplies, counseling, training, or reimbursement-style supports exist outside Medicaid eligibility alone.
119

Oregon Project Independence home-care supports

ImplementationOregon Project Independence services activeLive · Effectiveofficial · new

Oregon Project Independence provides limited in-home services to help older adults and people with disabilities continue living independently at home.

What changes for caregivers
Oregon continues to operate OPI as an in-home service pathway, alongside Medicaid-linked OPI-M rules under the state's long-term services infrastructure.
Why it matters
Home-care supports can determine whether families can avoid facility placement, reduce unpaid caregiver time, or bridge gaps when full Medicaid LTSS is not yet available.
120

Connecticut HUSKY Health renewal pathways

ImplementationHUSKY renewal pathways activeLive · Effectiveofficial · new

Connecticut HUSKY members renew coverage through Access Health CT or the Department of Social Services depending on the HUSKY program category.

What changes for caregivers
Connecticut maintains separate renewal and account-management routes for HUSKY A, B, D, and C members through Access Health CT, DSS, and ConneCT.
Why it matters
Caregivers often manage renewal notices, account access, and category-specific Medicaid paperwork; the wrong portal can delay or interrupt coverage.
121

Illinois Medicaid renewal redetermination

ImplementationAnnual Medicaid redetermination activeLive · Effectiveofficial · new

Illinois Medicaid members must renew coverage each year through redetermination, with due dates and notices managed through HFS and Manage My Case.

What changes for caregivers
Illinois HFS requires Medicaid members to renew annually through redetermination and directs members to watch for renewal forms, confirm address information, and use Manage My Case.
Why it matters
Renewal paperwork is a recurring caregiver burden; missed forms or stale contact information can disrupt medications, managed care, HCBS, and clinical access.
122

Oregon Health Plan renewal redetermination

ImplementationOHP renewal guidance activeLive · Effectiveofficial · new

Oregon Health Authority tells Oregon Health Plan members to renew coverage by confirming eligibility and sending information when a renewal letter asks for it.

What changes for caregivers
Oregon maintains OHP renewal workflows through ONE Online, ONE Customer Service, local ODHS offices, and community renewal partners.
Why it matters
Caregivers often handle eligibility letters, document uploads, interviews, and calls; missing an OHP renewal step can interrupt health and long-term-care access.
123

Oregon ADRD state plan and dementia roadmap

GuidanceDementia planning and roadmap materials activeLive · Implementingofficial plus tracker · new

Oregon's ADRD planning materials and dementia roadmap identify caregiver-informed priorities for people living with Alzheimer's disease and related dementias.

What changes for caregivers
Oregon has state-plan and roadmap materials for ADRD that include caregiver lived experience and practical post-diagnosis navigation resources.
Why it matters
Dementia policy becomes useful to families when it turns into diagnosis guidance, resource navigation, safety planning, and caregiver support pathways.
124

Washington durable power of attorney and health care directive

LegislationWashington planning documents activeLive · Effectiveofficial · new

Washington DSHS explains that people can use powers of attorney and health care directives to choose trusted helpers and document treatment wishes.

What changes for caregivers
Washington maintains planning routes for durable power of attorney and health care directives so people can name trusted decision-makers and record treatment preferences.
Why it matters
Caregiver access and decision authority often depend on planning documents that must be completed before incapacity or care transitions.
125

Pennsylvania hospice care family support

ImplementationHospice agency oversight and family-support pathway activeLive · Effectiveofficial · new

Pennsylvania Department of Health describes hospice as care that provides comfort, symptom control, and support for patients and families when life-limiting illness no longer responds to cure-oriented treatment.

What changes for caregivers
Pennsylvania's hospice framework keeps symptom control, emotional and spiritual support, and bereavement services visible as part of regulated end-of-life care.
Why it matters
Hospice access changes what families need to decide, document, coordinate, and ask about when serious illness shifts from cure-oriented treatment to comfort-focused support.
126

Connecticut nursing home inspection quality process

EnforcementNursing home inspection process activeLive · Effectiveofficial · new

Connecticut DPH describes nursing home inspections that review resident care, staff and resident interactions, the environment, clinical records, and interviews with residents and family members.

What changes for caregivers
Connecticut's nursing home oversight process gives families a state inspection and complaint frame for quality, care-process, and environmental concerns.
Why it matters
Caregivers need to know where quality complaints go, what inspectors review, and whether family interviews can become part of the accountability record.
127

Massachusetts nursing home survey performance tool

EnforcementSurvey performance tool activeLive · Effectiveofficial · new

Massachusetts DPH provides a Nursing Home Survey Performance Tool that compiles information about individual nursing homes from recertification and complaint surveys.

What changes for caregivers
Massachusetts makes nursing home survey and complaint-survey information available through a state performance tool.
Why it matters
Families comparing facilities need inspection and complaint-survey data that translates quality oversight into practical care decisions.
128

Maryland Office of Health Care Quality complaint process

EnforcementOHCQ complaint routing activeLive · Effectiveofficial · new

Maryland's Office of Health Care Quality monitors health care facilities and community-based programs and routes complaints through an online complaint process.

What changes for caregivers
Maryland's OHCQ provides the official complaint and monitoring channel for health care facilities and community-based programs.
Why it matters
When caregivers see unsafe care, neglect, or facility failures, they need a concrete state complaint route and a way to understand who oversees the provider.
129

Oregon long-term care facility quality complaints

EnforcementFacility complaint pathways activeLive · Effectiveofficial · new

Oregon DHS provides complaint pathways for nursing homes, residential care, assisted living facilities, and adult foster homes when there are quality-of-care concerns.

What changes for caregivers
Oregon maintains separate complaint routes for nursing facilities, residential care, assisted living, and adult foster homes.
Why it matters
Caregivers need to know which oversight route matches the care setting because nursing home, assisted living, and adult foster home complaints can go to different channels.
130

Pennsylvania nursing home complaint process

EnforcementNursing home complaint process activeLive · Effectiveofficial · new

Pennsylvania Department of Health tells nursing home patients and families how to file concerns or complaints by phone, online form, email, mail, or fax.

What changes for caregivers
Pennsylvania provides a Department of Health complaint route for nursing home patients, families, and representatives.
Why it matters
Families need a concrete escalation pathway when facility concerns are not resolved locally or when care quality creates safety risks.
131

Washington long-term care facility complaint process

EnforcementFacility complaint and ombudsman pathways activeLive · Effectiveofficial · new

Washington DOH explains that complaints about some facilities, including nursing homes and assisted living facilities, are regulated through DSHS complaint channels.

What changes for caregivers
Washington directs facility complaints across DOH and DSHS pathways and maintains an ombudsman program for long-term care residents.
Why it matters
Caregivers need to know whether a complaint belongs with DOH, DSHS, or the ombudsman when quality, abuse, discharge, restraint, or dignity issues arise.
132

California CCPA ADMT, risk assessment, and cybersecurity regulations

RegulationRegulations effective January 1, 2026Live · Effectiveofficial · new

California finalized privacy regulations addressing automated decisionmaking technology, risk assessments, and cybersecurity audits, with the rules effective January 1, 2026 and some compliance deadlines phased later.

What changes for caregivers
California's privacy regulator finalized rules that affect automated decisionmaking, privacy risk assessment, and cybersecurity audit obligations.
Why it matters
Caregiving tools that use profiling, automation, sensitive data, or digital health workflows may need stronger notices, rights handling, and risk governance.
133

Connecticut consumer health data privacy protections

RegulationConsumer health data obligations activeLive · Effectiveofficial · new

Connecticut's Data Privacy Act applies to Consumer Health Data Controllers that do business in Connecticut or target Connecticut residents, without the usual revenue or processing thresholds.

What changes for caregivers
Connecticut's privacy framework gives consumer health data its own coverage path for controllers targeting Connecticut residents.
Why it matters
Caregiver-facing tools may process symptom notes, care tasks, location, or other health-adjacent data that falls outside traditional HIPAA workflows.
134

Illinois biometric privacy rules for care technology

LegislationBiometric privacy law activeLive · Effectiveofficial · new

Illinois' Biometric Information Privacy Act governs private-entity handling of biometric identifiers and biometric information, with specific exclusions for some health care setting and HIPAA treatment, payment, and operations data.

What changes for caregivers
Illinois keeps biometric privacy obligations directly relevant to tools that use voice, facial geometry, fingerprints, or similar identifiers outside exempt health care contexts.
Why it matters
Care tools may use biometrics for access, monitoring, transcription, or identity; caregivers and vendors need to know when notice, consent, and retention rules matter.
135

Pennsylvania Consumer Data Privacy Act proposal

Legislation2025-2026 session privacy bill activePending · Activeofficial · new

Pennsylvania HB78 would create consumer data privacy duties for controllers and processors and impose penalties.

What changes for caregivers
Pennsylvania has a 2025-2026 consumer data privacy bill that would create controller and processor duties if enacted.
Why it matters
A Pennsylvania privacy law would affect how caregiver-facing services manage personal, sensitive, health-adjacent, and family data for residents.
136

Texas STAR+PLUS home and community-based services

ImplementationSTAR+PLUS and HCBS pathways activeLive · Effectiveofficial · new

Texas STAR+PLUS is a Medicaid managed care program for adults with disabilities and adults 65 or older, including long-term services and supports through managed care.

What changes for caregivers
Texas continues to route many older adults and adults with disabilities through STAR+PLUS managed care for acute care and long-term services and supports, with separate HCBS waiver pathways for additional community supports.
Why it matters
Caregivers in Texas need to understand managed-care plan choice, service coordination, HCBS interest-list steps, and what supports can keep someone out of an institution.
137

Colorado FAMLI caregiving leave

ImplementationFAMLI caregiving benefits activeLive · Effectiveofficial · new

Colorado's FAMLI program provides partial wage replacement for workers who need time away to care for a loved one with a serious health condition.

What changes for caregivers
Colorado workers can use FAMLI for covered caregiving events, and the state describes the program as providing both wage replacement and employment protections for eligible workers.
Why it matters
Paid leave can determine whether a caregiver can attend care transitions, manage serious illness, or stay employed while providing family care.
138

Minnesota Paid Leave caring leave launch

ImplementationPaid Leave launched January 1, 2026Live · Effectiveofficial · new

Minnesota Paid Leave launched January 1, 2026 and provides payments, job protections, and health insurance continuation for eligible workers, including caring leave for a family member with a serious health condition.

What changes for caregivers
Minnesota's paid leave program is live, including caring leave for workers who need time away to care for a family member with a serious health condition.
Why it matters
Families need clear guidance on certification, paid benefits, job protection, and how caring leave interacts with acute illness, hospice, dementia, or disability caregiving.
139

New Hampshire HB 143 responsive generative communication

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Adds child-safety restrictions involving responsive generative communication and AI-enabled interaction with minors.

What changes for caregivers
Adds child-safety restrictions involving responsive generative communication and AI-enabled interaction with minors.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
140

California SB 243 companion chatbot safety law

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Requires companion chatbot disclosures, suicide and self-harm safeguards, protections for minors, and reporting obligations for operators.

What changes for caregivers
Requires companion chatbot disclosures, suicide and self-harm safeguards, protections for minors, and reporting obligations for operators.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
141

California AB 489 artificial intelligence health-care title protection

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Restricts AI systems from representing themselves with licensed health-care titles or implying licensed clinical authority.

What changes for caregivers
Restricts AI systems from representing themselves with licensed health-care titles or implying licensed clinical authority.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
142

Texas HB 149 Texas Responsible Artificial Intelligence Governance Act

LegislationEffective 2026-01-01Live · Effectiveofficial · updated

Creates a state AI regulatory framework, disclosure requirements for certain AI users including health care service providers, prohibited AI uses, enforcement, a sandbox, and an AI council.

What changes for caregivers
Creates a state AI regulatory framework, disclosure requirements for certain AI users including health care service providers, prohibited AI uses, enforcement, a sandbox, and an AI council.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
143

New Jersey Parkinson's disease registry proposal

LegislationReported to Assembly Appropriations on January 5, 2026Pending · Activeofficial · new

New Jersey's S2339 would establish a State Parkinson's disease registry and has moved from the Senate to Assembly committee review.

What changes for caregivers
S2339 would establish a State Parkinson's disease registry; the official NJ Legislature page shows Senate passage on December 18, 2025 and Assembly committee movement on January 5, 2026.
Why it matters
Disease registries can improve service-planning visibility while raising plain-language questions for families about reporting, confidentiality, access to data, and whether registry participation changes care.
144

New Jersey Personal Preference Program fiscal-intermediary transition

ImplementationPPP FI transition workgroup active in 2026Live · Implementingofficial · new

New Jersey's Medicaid Personal Preference Program is running fiscal-intermediary transition resources and workgroups for self-directed personal care participants and workers.

What changes for caregivers
DMAHS posted PPP fiscal-intermediary transition resources; January 2026 materials describe Horizon NJ Health member transition from PPL to Palco and PPP reimbursement-rate changes effective January 1, 2026.
Why it matters
Fiscal-intermediary changes can disrupt enrollment, payroll, timesheets, and worker continuity even when a member's underlying personal-care need has not changed.
145

New York home-care nurse mandatory-overtime proposal

LegislationActive 2025-2026 session billsPending · Activeofficial · new

New York A8615/S7994 would add home care visits to state limits on requiring nurses to work beyond regularly scheduled hours.

What changes for caregivers
The Assembly and Senate bills would add regularly scheduled home care visits to existing law limiting when health care employers may require nurses to work beyond scheduled hours.
Why it matters
Home-care staffing rules can affect continuity, safety, and caregiver backup burden when families depend on scheduled nursing visits at home.
146

New Jersey PANDAS/PANS coverage proposal

LegislationIntroduced January 13, 2026Proposed · Proposedofficial · new

New Jersey A3246 would require health insurance coverage for diagnosis and treatment of PANDAS and PANS.

What changes for caregivers
A3246 was introduced and referred to the Assembly Financial Institutions and Insurance Committee; the bill text would require covered health plans to cover specified diagnosis and treatment expenses for PANDAS and PANS.
Why it matters
Coverage mandates can change family out-of-pocket burden and access to care for pediatric conditions that often require caregiver coordination across clinicians, schools, and insurers.
147

New Jersey ALS and motor neuron disease reporting law

LegislationApproved January 20, 2026; effective immediatelyLive · Effectiveofficial · updated

New Jersey approved P.L.2025, c.346, requiring health care professionals to report ALS and motor neuron disease cases to the Department of Health.

What changes for caregivers
A2980, identical to S4030, became P.L.2025, c.346 and requires health care professionals who screen for, diagnose, or provide therapeutic services to patients with ALS or motor neuron disease to confidentially report known cases to the Department of Health.
Why it matters
A registry and reporting rule can improve visibility into ALS and motor neuron disease prevalence and service needs, while families need clear explanation of reporting, confidentiality, data sharing, and DOH implementation materials.
148

Federal dementia national-plan caregiver guidance

GuidanceFederal Advisory Council 2026 update planning notice published January 23, 2026Pending · Activeofficial · new

HHS maintains National Alzheimer's Project Act guidance through the National Plan to Address Alzheimer's Disease, including caregiver and family-support goals for Alzheimer's disease and related dementias.

What changes for caregivers
HHS/ASPE keeps the National Plan as the federal guidance layer for Alzheimer's disease and related dementias. The 2025 update remains the current published plan update, while the 2026 Federal Register meeting notice says the Advisory Council will discuss updating the plan for 2026-2035.
Why it matters
Dementia is one of the highest-burden caregiver conditions; the National Plan is the official federal roadmap tying research, care quality, public health, services, and caregiver supports together.
149

DC Paid Family Leave family-care benefits

Implementation2026 employee notice availableLive · Effectiveofficial · new

DC Paid Family Leave provides up to 12 weeks to care for a family member with a serious health condition.

What changes for caregivers
DC's paid leave program continues to provide family-care benefits and requires employers to post and provide the 2026 employee notice.
Why it matters
Caregivers need to know whether they can use paid time away from work for serious illness care and what application or employer-notice steps apply.
150

CMS repeals federal nursing-home minimum staffing provisions

RegulationEffective February 2, 2026Live · Effectiveofficial · updated

CMS issued an interim final rule removing the 2024 federal 24/7 RN and HPRD minimum staffing provisions after a public-law moratorium and litigation changed enforceability.

What changes for caregivers
CMS issued an interim final rule removing the 2024 federal 24/7 RN and HPRD minimum staffing provisions after a public-law moratorium and litigation changed enforceability.
Why it matters
Families may still see staffing problems, but the federal minimum-staffing baseline should not be described as currently enforceable; state rules, inspection findings, PBJ staffing data, and complaint routes become more important.
151

ALS Better Care Act reintroduced

Legislation119th CongressProposed · Proposedofficial plus tracker · new

Federal lawmakers reintroduced legislation to create a supplemental Medicare payment for multidisciplinary ALS care.

What changes for caregivers
The bill would support ALS clinics with a supplemental Medicare payment intended to sustain team-based care.
Why it matters
ALS caregivers often coordinate respiratory, mobility, nutrition, communication, social work, and palliative needs; clinic access can change the entire care plan.
152

Lifespan Respite Care reauthorized through FY2030

LegislationAuthorized through FY2030Live · Effectiveofficial · new

Congress reauthorized the federal Lifespan Respite Care Program through fiscal year 2030 and clarified that caregivers under 18 may be eligible for respite services.

What changes for caregivers
The program was renewed through FY2030, with language expanding the family caregiver definition from unpaid adult to unpaid individual.
Why it matters
Respite is a practical pressure valve for caregivers; the under-18 clarification also makes youth caregiving visible in federal program design.
153

HHS OCR health-information privacy complaint enforcement

EnforcementHHS HIPAA complaint page last reviewed February 13, 2026Pending · Activeofficial · new

HHS OCR maintains the federal complaint pathway for HIPAA, breach-notification, and Part 2 health-information privacy concerns, including complaints filed for oneself or for someone else.

What changes for caregivers
HHS OCR complaint materials say people may file if a covered entity or business associate violated their or someone else's health-information privacy rights, that OCR can investigate HIPAA and Part 2 complaints against regulated entities, and that the OCR portal supports complaints filed for oneself or for someone else.
Why it matters
Caregivers often discover privacy and access problems while trying to coordinate care; this row gives the official federal enforcement route without treating a complaint as immediate access authority or individualized HIPAA advice.
154

New York nursing-home staffing and direct-care spending requirements

RegulationOngoing; staffing law current revision February 27, 2026Live · Effectiveofficial · updated

New York law requires nursing homes to maintain minimum staffing hours and follow direct-care spending rules with audit and recoupment mechanisms.

What changes for caregivers
New York law requires nursing homes to maintain minimum staffing hours and publicly post staffing information; separate direct-care spending rules require minimum spending on direct resident care and resident-facing staffing, with audit and recoupment mechanisms.
Why it matters
This is a state-level accountability lane families can use to understand staffing, resident-facing spending, and why facility quality concerns may trigger DOH oversight rather than only federal action.
155

Massachusetts Frail Elder Waiver home and community supports

Implementation2026 applicant and participant guidance activeLive · Effectiveofficial · new

Massachusetts' Frail Elder Waiver is a MassHealth home- and community-based services waiver for eligible adults age 60 and older who need nursing-facility-level care.

What changes for caregivers
Massachusetts continues to operate the Frail Elder Waiver as an HCBS pathway for older adults who meet clinical and financial eligibility rules and want supports outside an institution.
Why it matters
For caregivers, the practical issue is not just whether a waiver exists; it is whether the family can understand eligibility, service planning, and how home supports compare with facility care.
156

New York Serious Illness Care Equity Act proposal

LegislationAssembly companion referred March 6, 2026; Senate bill activePending · Activeofficial · new

New York bills would create a statewide advance care planning public awareness campaign and community-based outreach grants.

What changes for caregivers
Proposed legislation would operationalize a statewide advance care planning public awareness campaign and create community-based outreach grants.
Why it matters
Advance planning burden often falls on families late; multilingual community navigation could make proxy and care-preference documentation more reachable.
157

New Jersey long-term-care facility regulatory framework

RegulationNJLTCO statutes and regulations page updated March 24, 2026Live · Effectiveofficial · new

New Jersey DOH and the Long-Term Care Ombudsman identify the state rules and resident-rights framework for nursing homes, assisted living, residential health care, adult day health services, and other long-term care settings.

What changes for caregivers
NJDOH lists the health-facility rule chapters for long-term care settings, including N.J.A.C. 8:39 for long-term care facilities, N.J.A.C. 8:36 for assisted living, and N.J.A.C. 8:43E for general licensure and enforcement; NJLTCO maps resident-rights statutes and regulations across long-term care settings.
Why it matters
Families need to know which state rule set governs a facility before deciding whether a concern belongs with the facility, DOH, LTCO, or another oversight route.
158

New York palliative and hospice access standards proposal

LegislationA10316 referred February 20, 2026; S9621 introduced March 30, 2026Pending · Activeofficial · new

New York bills would strengthen identification, documentation, counseling, referral, reporting, and demonstration-project rules for palliative and hospice access.

What changes for caregivers
Proposed legislation would amend NY Public Health Law to strengthen identification, documentation, counseling, referral, reporting, and demonstration-project rules for palliative and hospice access.
Why it matters
If enacted, facilities would face clearer serious-illness referral workflows and families could get earlier palliative or hospice conversations.
159

New Jersey health care service firm complaint and enforcement route

EnforcementConsumer Affairs HCSF page updated March 30, 2026Pending · Activeofficial · new

New Jersey Consumer Affairs regulates health care service firms that place workers providing health care, companion care, or personal care in homes and provides a public complaint route.

What changes for caregivers
The New Jersey Division of Consumer Affairs identifies health care service firms as agencies placing personnel for health, companion, or personal care in the residence of a person with a disability or an older adult, lists primary laws and regulations it enforces, and provides complaint channels for consumers and licensed-professional or unlicensed-activity concerns.
Why it matters
Families buying or receiving home care need to distinguish Medicaid service rules from state oversight of firms that place workers in private residences. This row anchors the state complaint/enforcement route without guaranteeing an investigation or outcome.
160

NJ FamilyCare community-based palliative care benefit

ImplementationBenefit available April 1, 2026Live · Implementingofficial · new

New Jersey implemented a Medicaid/NJ FamilyCare community-based palliative care benefit for members with serious health conditions, available alongside current treatment.

What changes for caregivers
New Jersey implemented a Medicaid/NJ FamilyCare community-based palliative care benefit for members with serious health conditions, available alongside current treatment and outside the hospice benefit.
Why it matters
This creates a concrete benefit route for symptom management, goal-setting, and care coordination before hospice eligibility.
161

Maryland Online Data Privacy Act implementation

LegislationEffective October 1, 2025; enforcement begins April 1, 2026Live · Effectiveofficial · new

Maryland's Online Data Privacy Act is in effect and creates consumer data rights and controller obligations that can affect care-adjacent digital services.

What changes for caregivers
Maryland enacted a comprehensive privacy law regulating how controllers and processors handle consumer personal data, including rights and obligations relevant to sensitive care-adjacent data.
Why it matters
Caregiver tools can hold household, health, location, and support-needs data; Maryland is a useful state model for privacy rights and vendor obligations outside HIPAA-only framing.
162

Medicare caregiver training services billing guidance

GuidanceCMS FAQ updated for 2024-2026 caregiver training codesLive · Effectiveofficial · new

CMS maintains Medicare billing guidance for caregiver training services, including codes adopted beginning in 2024 and additional HCPCS codes beginning in 2025.

What changes for caregivers
CMS guidance explains caregiver training services under the Medicare Physician Fee Schedule, including CPT codes beginning January 1, 2024 and HCPCS codes G0539-G0543 beginning January 1, 2025, with telehealth treatment in the CY 2025 Physician Fee Schedule final rule and 2026 MLN mental-health coverage materials.
Why it matters
Caregiver training can turn a clinical plan into work families can actually carry out at home, but caregivers need explanation that this is clinician billing guidance rather than a guaranteed standalone caregiver benefit.
163

Virginia CCC Plus Waiver home and community-based services

ImplementationCCC Plus waiver amendment/comment cycle active in 2026Live · Effectiveofficial · new

Virginia's Commonwealth Coordinated Care Plus Waiver is an HCBS waiver for older adults, people with physical disabilities, and people who are chronically ill or severely impaired.

What changes for caregivers
Virginia maintains CCC Plus as a major HCBS route and posted 2026 waiver amendment materials through its public regulatory process.
Why it matters
Caregivers need to know whether CCC Plus can support home care, how Medicaid eligibility and waiver screening work, and where waiver changes may affect service continuity.
164

Alaska Medicaid member resources guidance

GuidanceMember resources page current April 7, 2026Pending · Activeofficial · new

Alaska Medical Assistance member resources point Medicaid members to the recipient handbook, eligibility guidelines, fair-hearing materials, member portal, DPA contact center, and member hotline.

What changes for caregivers
Alaska's Medical Assistance member page groups the member portal, recipient handbook, fair-hearing materials, eligibility guidelines, DPA Virtual Contact Center, member hotline, and transportation resources in one official member doorway.
Why it matters
For caregivers managing Medicaid paperwork, the first practical problem is often finding the official handbook, eligibility route, appeal material, and help line before a renewal or service issue turns into a coverage gap.
165

HHS OCR disability-rights health-care enforcement

EnforcementHHS OCR disability-rights enforcement release last revised April 13, 2026Pending · Activeofficial · new

HHS OCR maintains complaint and resolution pathways for disability discrimination in HHS-funded or HHS-operated health and social service programs, including effective-communication enforcement under Section 504 and Section 1557.

What changes for caregivers
HHS OCR's 2026 disability-rights enforcement release describes resolution agreements requiring health-care providers to assess communication needs, update Section 504 and Section 1557 policies, provide auxiliary aids and qualified interpreters, train staff, and accept OCR monitoring.
Why it matters
Disability-rights enforcement is a practical backstop when inaccessible communication, medical settings, or service systems block people with disabilities and their caregivers from care.
166

Maine Paid Family and Medical Leave benefits launch

ImplementationBenefits available for leave on or after May 1, 2026Live · Effectiveofficial · new

Maine Paid Family and Medical Leave lets eligible workers apply for up to 12 weeks of paid time for medical, parental, family care, military family, or safe leave beginning May 2026.

What changes for caregivers
Maine's PFML benefits are available for eligible leave beginning May 1, 2026, with applications opening before the benefit date.
Why it matters
This is a new 2026 caregiver-support lane for workers who need income replacement and job protection while caring for a loved one.
167

Maryland State Advisory Council on Serious Illness Care

Guidance2026 meeting schedule activeLive · Implementingofficial · new

Maryland's State Advisory Council on Serious Illness Care studies state policy effects on care for people with life-limiting illnesses and care for the dying.

What changes for caregivers
Maryland maintains a public advisory council that studies how statutes, regulations, policies, and public policy affect care for the dying and people with life-limiting illness.
Why it matters
This is a policy-intelligence lane for tracking serious-illness care priorities, education, and state-level end-of-life policy development before it becomes a direct benefit or mandate.
168

Alaska public assistance online application implementation

ImplementationApplication portal launch bulletin May 22, 2026Live · Implementingofficial · new

Alaska launched a mobile-friendly Application for Services so new applicants can apply online for Medicaid, long-term care, Senior Benefits, SNAP, Adult Public Assistance, and other public assistance programs through a single smart form.

What changes for caregivers
The Alaska Department of Health announced a mobile-friendly online Application for Services through Alaska Connect. The bulletin says new applicants can use one smart form for MAGI Medicaid, Aged Blind and Disabled Medicaid, SNAP, Adult Public Assistance, ATAP, Senior Benefits, Long-Term Care, and General Relief Assistance, with document upload and optional text or email confirmation.
Why it matters
Caregivers often manage multi-program applications and supporting documents. A single online application path can reduce duplicate paperwork, but families still need plain-language routing, document reminders, and backup phone or office options.
169

New York aging and caregiver-support budget appropriations

BudgetFY2026-2027 budget signed May 28, 2026Passed · Signedofficial · new

New York budget materials include aging and caregiver-support appropriations, including caregiver resource centers, caregiver training, Title III-E caregiver funds, dementia caregiver support, and respite-related lines.

What changes for caregivers
The Aid to Localities budget materials carry caregiver-specific lines, including caregiver resource centers, TRUALTA caregiver training and supports, Title III-E caregiver funds, dementia caregiver support services, and respite relief for high-need family caregivers.
Why it matters
These budget lines are not individual benefits determinations, but they point to caregiver-support infrastructure that can affect respite, training, local aging-service capacity, and dementia-family support.
170

New York health budget home-care and Medicaid package

BudgetSigned as Chapter 57 on May 28, 2026Passed · Signedofficial · new

New York signed the FY2026-2027 health and mental hygiene budget package, which includes home-care, Medicaid, behavioral-health, and disability-service implementation provisions.

What changes for caregivers
S9007C/A10007C became Chapter 57 and implements the state health and mental hygiene budget, including extensions and implementation language around personal care worker recruitment and retention, home-care worker insurance pilots, Medicaid payment provisions, and the care demonstration program.
Why it matters
The package is too broad for a single caregiver instruction, but it is a high-priority source for downstream Medicaid, home-care, workforce, and disability-service explainers.
171

New York dependent-care credit and rent-exemption budget changes

BudgetSigned as Chapter 59 on May 28, 2026Passed · Signedofficial · new

New York signed budget tax provisions that include a child and dependent care credit beginning in tax year 2026 and rent-exemption notice provisions for senior and disabled tenants.

What changes for caregivers
S9009C/A10009C became Chapter 59 and includes budget tax provisions for a child and dependent care credit for taxable years beginning on or after January 1, 2026, plus senior and disability rent-exemption notice provisions.
Why it matters
Financial-support and notice changes can affect caregiver household budgets and whether older or disabled tenants learn about rent-exemption programs, but the row is a watch item rather than tax or benefits advice.
172

Federal Section 1557 health-care nondiscrimination rule

RegulationPartial vacatur notice published June 2, 2026; 2024 final rule effective July 5, 2024Closed · Under Litigationofficial · new

HHS's Section 1557 rule remains the federal health-care nondiscrimination regulation for disability and other protected bases, with a 2026 vacatur notice clarifying that some gender-identity provisions are legally void while disability protections remain in force.

What changes for caregivers
HHS published the 2024 Section 1557 final rule for nondiscrimination in health programs and activities. A June 2026 Federal Register notice says a federal court vacated specific gender-identity provisions, but the other provisions of the Section 1557 rule remain in force, including disability-related protections.
Why it matters
Caregivers helping disabled people or people with chronic conditions need a current federal reference that preserves disability nondiscrimination protections while flagging the litigated portions of the rule.
173

New York Social Care Networks under Medicaid 1115 waiver

ImplementationScreening update posted June 4, 2026Live · Implementingofficial · new

New York's Social Care Networks connect eligible Medicaid members to health-related social needs services such as nutrition, housing, transportation, and care-navigation supports.

What changes for caregivers
The NYHER 1115 waiver's Social Care Networks are moving from waiver authority into operational screening and referral infrastructure for eligible Medicaid members.
Why it matters
Families may encounter a new doorway for food, housing, transportation, and social-care referrals, but eligibility and navigation details can add paperwork if not explained plainly.
174

New York Medical Assistance coverage statutes

LegislationCurrent NY Senate revision June 5, 2026Live · Effectiveofficial · new

New York Social Services Law provisions define the state's Medical Assistance coverage framework, including covered services, eligibility categories, and application-related rules that shape Medicaid access.

What changes for caregivers
NY Social Services Law sections 365-a, 366, and 366-a remain the statutory backbone for Medical Assistance services, eligibility groups, and application-related rules.
Why it matters
Caregivers managing Medicaid paperwork need to distinguish the public guidance layer from the underlying state-law framework before notices, appeals, spenddown questions, or service coverage disputes become urgent.
175

Oregon Death with Dignity Act reporting

Implementation2025 annual report revised June 17, 2026Live · Effectiveofficial · new

Oregon's Death with Dignity Act remains an active end-of-life policy model with annual state reporting on participation.

What changes for caregivers
Oregon continues to publish annual reporting for the Death with Dignity Act, making it a long-running implementation and data model for medical aid-in-dying policy.
Why it matters
As New York and other states implement MAID laws, Oregon's reporting model helps explain safeguards, utilization, and family-facing administrative questions.
176

California CalAIM Community Supports and caregiver respite

ImplementationCommunity Supports implementation activeLive · Implementingofficial · new

California's CalAIM Community Supports let Medi-Cal managed care plans offer non-medical supports, including housing, meals, personal care, and respite-related services.

What changes for caregivers
CalAIM Community Supports are a Medi-Cal managed-care pathway for non-medical services that can keep people stable at home or after discharge.
Why it matters
Families may need help distinguishing medical benefits, social supports, plan availability, and documentation requirements in a managed-care system.
177

Massachusetts data privacy legislation

LegislationComprehensive data privacy legislation activePending · Activeofficial · new

Massachusetts lawmakers are advancing comprehensive data privacy legislation, with the Senate announcing passage of the Massachusetts Data Privacy Act in 2025 and House consideration continuing in 2026.

What changes for caregivers
Massachusetts is actively considering comprehensive data privacy rules that could reshape how digital services collect, sell, and process sensitive personal data.
Why it matters
Caregiver-facing tools can involve sensitive routines, location, health-adjacent notes, and family data even when they are not formal medical records.
178

CMS nursing-home survey and enforcement transparency

EnforcementSpecial Focus Facility materials updated June 24, 2026Live · Effectiveofficial · new

CMS maintains national nursing-home certification, survey, enforcement, Special Focus Facility, and Care Compare transparency materials that families can use when evaluating facility quality concerns.

What changes for caregivers
CMS's nursing-home certification and compliance materials identify how survey findings feed compliance certification and enforcement recommendations, while the current nursing-home page links the June 2026 Special Focus Facility posting and Care Compare quality resources.
Why it matters
Families and caregivers often need an evidence-backed way to understand whether a facility has inspection, staffing, quality, or enforcement concerns before making placement, transfer, or complaint decisions.
179

NIH National Plan to End Parkinson's implementation

ImplementationAdvisory Council meeting June 29, 2026Live · Implementingofficial · new

NIH is leading implementation of the National Plan to End Parkinson's Act, including an advisory council and national planning process for Parkinson's research, care, and services.

What changes for caregivers
NIH is implementing Public Law 118-66 through a National Plan process and advisory council focused on Parkinson's research, care, and services.
Why it matters
The implementation process includes care coordination, diagnosis, caregiver and family impact, and Parkinson's-related dementia, making it a strong specialty-care pathway row.
180

California neurodegenerative disease registry expands ALS reporting

ImplementationALS reporting starts July 1, 2026Live · Effective Soonofficial · new

California's Department of Public Health says ALS reporting into the California Neurodegenerative Disease Registry starts July 1, 2026.

What changes for caregivers
California is adding ALS to mandatory neurodegenerative disease reporting, requiring providers who diagnose or treat reportable neurodegenerative disease to submit case information to CDPH.
Why it matters
Registry reporting can improve disease surveillance and research visibility, but it also creates new data, privacy, and explanation needs for ALS families and care teams.
181

Pennsylvania Community HealthChoices waiver amendment

ImplementationWaiver amendment effective July 1, 2026Live · Effective Soonofficial · new

Pennsylvania is submitting a Community HealthChoices home- and community-based services waiver amendment with an effective date of July 1, 2026.

What changes for caregivers
Pennsylvania DHS is moving a Community HealthChoices 1915(c) HCBS waiver amendment into a July 1, 2026 effective window.
Why it matters
CHC is the long-term services and supports pathway many caregivers encounter when trying to keep an older adult or disabled adult supported outside a facility.
182

Federal FMLA caregiver leave regulations

RegulationeCFR Title 29 Part 825 current issue date July 1, 2026Live · Effectiveofficial · new

Federal FMLA regulations define when eligible workers may take job-protected leave to care for a spouse, child, parent, or covered servicemember with a serious health condition or injury.

What changes for caregivers
The current eCFR text for 29 CFR Part 825 keeps the operative caregiver leave rules in one official source: qualifying leave to care for a spouse, son, daughter, or parent with a serious health condition; military caregiver leave; intermittent or reduced-schedule leave; and certification rules for care needs.
Why it matters
This is the regulation-level backbone behind federal caregiver leave explainers, separating enforceable FMLA rights from broader caregiver-support strategy and state paid-leave programs.
183

Federal hospital discharge-planning caregiver implementation

ImplementationeCFR 42 CFR 482.43 current issue date July 1, 2026; transfer protocols effective July 1, 2025Live · Effectiveofficial · new

Federal hospital conditions of participation require discharge planning to include patients and caregivers or support persons as active partners in post-discharge care planning.

What changes for caregivers
The current eCFR text for 42 CFR 482.43 says the hospital discharge-planning process must focus on patient goals and treatment preferences, include the patient and caregivers/support persons as active partners, provide discharge-planning evaluation on request of the patient, patient's representative, or physician, and help patients, families, or representatives use post-acute quality and resource-use data.
Why it matters
Discharge is where many family caregivers inherit complex tasks. This row is the federal implementation anchor for explaining when caregivers and representatives should be brought into planning, without replacing state CARE Act or hospital-specific rights.
184

Vermont H.814 mental health chatbot regulation

LegislationEffective 2026-07-01Live · Effective Soonofficial · updated

Regulates mental health chatbots, including representations about psychotherapy or treatment and conduct by chatbot suppliers.

What changes for caregivers
Regulates mental health chatbots, including representations about psychotherapy or treatment and conduct by chatbot suppliers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
185

Tennessee SB 1580 AI mental-health professional restriction

LegislationEffective 2026-07-01Live · Effective Soonofficial · updated

Restricts artificial intelligence systems from representing themselves as licensed mental-health professionals or providing certain professional mental-health services.

What changes for caregivers
Restricts artificial intelligence systems from representing themselves as licensed mental-health professionals or providing certain professional mental-health services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
186

New York nursing-home complaint and inspection guidance

GuidanceNYS Health Profiles guidance activeLive · Effectiveofficial · new

NYS Health Profiles explains how nursing-home inspections, complaint surveys, citations, correction dates, Statements of Deficiencies, and complaint investigations work.

What changes for caregivers
NYS Health Profiles explains that DOH licenses nursing homes, conducts certification surveys every 9 to 15 months, conducts complaint and incident investigations, issues citations when regulatory requirements are not met, requires acceptable plans of correction, and presents inspection reports for public comparison.
Why it matters
Facility quality concerns often turn into confusing documents; caregivers need plain language for when to file a complaint, how to read a citation, and why a correction date or Statement of Deficiencies matters.
187

New York Nursing Home Quality Initiative implementation

ImplementationAnnual NHQI dataset activeLive · Effectiveofficial · new

New York's Nursing Home Quality Initiative is an annual quality and performance evaluation for Medicaid-certified nursing homes using quality, compliance, and efficiency measures.

What changes for caregivers
Health Data NY describes NHQI as an annual NY Department of Health evaluation and ranking project for eligible Medicaid-certified nursing homes, with quality, compliance, and efficiency components and facility-level quintile results.
Why it matters
Caregivers comparing nursing facilities need to understand that quality data is a historical facility-level signal and should be paired with inspections, complaints, visits, ombudsman input, and current availability.
188

Federal advance-directive and patient self-determination authority

LegislationCurrent U.S. Code and eCFR advance-directive requirements verified July 4, 2026Live · Effectiveofficial · new

Federal Medicare provider-agreement law requires covered providers and organizations to maintain written policies and give adults information about state-law medical decision rights and advance directives.

What changes for caregivers
42 U.S.C. 1395cc(f) requires covered providers and organizations to maintain written policies and procedures for adult individuals, provide written information about state-law rights to accept or refuse medical or surgical treatment and formulate advance directives, document whether an advance directive exists, avoid discrimination based on advance-directive status, and educate staff and the community. Current 42 CFR Part 489 Subpart I implements those duties for hospitals, SNFs, home health agencies, hospices, and related provider types.
Why it matters
Advance directives and health-care agents are core legal-authority pathways for family caregivers, but the federal row must stay clear that state law controls the actual directive and representative authority.
189

New York data breach and SHIELD Act enforcement route

EnforcementOAG breach reporting and SHIELD Act enforcement route verified July 4, 2026Pending · Activeofficial · new

The New York Attorney General receives and investigates data-breach reports and describes SHIELD Act enforcement authority for injunctive relief, restitution, and civil penalties.

What changes for caregivers
The Attorney General's data-breach reporting page says the office receives and investigates reports of data breaches involving consumers' personal information. The SHIELD Act guidance says the Attorney General may seek injunctive relief, restitution, and penalties for violations of the law.
Why it matters
When a care-tech account, health-adjacent service, or provider-facing platform exposes personal information, families need a state enforcement route and a separate consumer-complaint path without assuming the complaint itself fixes access or safety issues.
190

New Jersey developmental-disability abuse reporting route

EnforcementDDD suspected-abuse reporting route verified July 4, 2026Pending · Activeofficial · new

New Jersey DDD maintains a 24/7 hotline for suspected abuse, neglect, or exploitation of individuals with intellectual or developmental disabilities, including anonymous reports by people with reasonable cause.

What changes for caregivers
New Jersey DDD says reports of suspected abuse, neglect, or exploitation of an individual with an intellectual or developmental disability can be made anonymously through the DDD hotline, available 24 hours a day, 7 days a week. The page also says calls may be made by any person with reasonable cause to believe an individual has been victimized, and that DHS employees and regulated provider staff must report allegations.
Why it matters
Families caring for adults with intellectual or developmental disabilities need a specific official reporting route when safety concerns arise in provider-funded, contracted, or regulated settings.
191

New Jersey disability caregiver services guidance

GuidanceState disability and caregiver guidance verified July 4, 2026Pending · Activeofficial · new

New Jersey's disability hub and caregiver resources pages route families to disability-service navigation, respite, personal care assistance, and aging-disability referral channels.

What changes for caregivers
New Jersey's Disability Information Hub offers live assistance for finding disability services, and the caregiver resources page directs families to special education, Statewide Respite Care through ADRC, and personal care assistance information through Medicaid managed care, the Division of Disability Services, MLTSS, and PACE.
Why it matters
This is the official state guidance layer for families trying to find disability and chronic-care supports before they know which program owns the next step.
192

New York Justice Center disability abuse reporting route

EnforcementJustice Center VPCR reporting route verified July 4, 2026Pending · Activeofficial · new

New York's Justice Center operates the Vulnerable Persons Central Register hotline for abuse, neglect, and mistreatment allegations involving people with special needs.

What changes for caregivers
The Justice Center reporting page says anyone, including a parent, advocate, or guardian, can report suspected abuse, neglect, or mistreatment of a person with special needs to the VPCR hotline, and that the VPCR is a 24/7 hotline and incident reporting system. Mandated reporters must report immediately, with delay allowed only for safety steps such as calling 911.
Why it matters
Families and caregivers need a state-specific route for safety concerns involving disability-service systems and vulnerable-person settings, distinct from health-facility or Medicaid appeals.
193

New York dementia caregiver guidance

GuidanceNYSDOH dementia caregiver guidance verified July 4, 2026Pending · Activeofficial · new

NYSDOH maintains dementia caregiver guidance and referral pages that point families to caregiver resources, the NYS Caregiver Guide, Alzheimer's Association chapters, and community-based dementia services.

What changes for caregivers
NYSDOH's dementia pages provide caregiver-facing guidance for caring for someone with Alzheimer's disease or other dementia, including links to where families can get help, the NYS Caregiver Guide, and community-based services for people with Alzheimer's disease and related dementias and their caregivers.
Why it matters
Dementia care creates recurring family workload around supervision, behavior changes, planning, and service navigation; this row gives the official New York guidance anchor without turning it into eligibility advice.
194

New York Alzheimer's caregiver support implementation

ImplementationNYSDOH Alzheimer's Disease Program initiatives verified July 4, 2026Live · Implementingofficial · new

NYSDOH implements dementia caregiver-support programming through Alzheimer's Disease Program initiatives and related caregiver-support investments.

What changes for caregivers
NYSDOH identifies funded Alzheimer's Disease Program initiatives and describes the NYS Caregiver Support Initiative as an annual investment in community support and health services for people with dementia and their caregivers.
Why it matters
This implementation row connects dementia-caregiver guidance to actual state-funded delivery channels, while leaving program eligibility and local provider details outside the public policy row.
195

New York hospital patient-rights complaint route

EnforcementNYSDOH hospital complaint route verified July 4, 2026Pending · Activeofficial · new

NYSDOH operates a written complaint route for care provided by New York hospitals and diagnostic and treatment centers.

What changes for caregivers
NYSDOH's facility complaint form says the Department is responsible for ongoing surveillance and investigation of complaints related to care provided by hospitals and diagnostic and treatment centers. The Patients' Bill of Rights also tells patients they may complain without fear of reprisals and may complain to the Health Department if dissatisfied with the hospital response.
Why it matters
Family caregivers often inherit unresolved discharge, communication, or care-quality problems. This row gives the official complaint-route anchor without promising that a complaint will be investigated or resolved in a particular way.
196

New York health care proxy family decision guidance

GuidanceNYSDOH health care proxy guidance verified July 4, 2026Pending · Activeofficial · new

NYSDOH explains how adults can appoint a trusted health care agent, such as a family member or close friend, to make medical decisions when they cannot.

What changes for caregivers
NYSDOH's public guidance and form explain health care proxy planning, while New York Public Health Law authorizes a competent adult to appoint a health care agent and gives that agent authority, subject to limits, to make health care decisions and receive medical information needed for informed decisions.
Why it matters
Caregivers need a clear boundary between informal caregiving, hospital discharge caregiver designation, and formal health care agent authority before a crisis makes documentation urgent.
197

CMS Medicaid HCBS authorities guidance

GuidanceCMS HCBS authorities guidance verified July 4, 2026Pending · Activeofficial · new

CMS explains the main Medicaid home- and community-based services authorities states can use, including 1915(c), 1915(i), 1915(j), and 1915(k).

What changes for caregivers
CMS's HCBS authorities page explains that states have several Medicaid HCBS options, including 1915(c) waivers, 1915(i) state plan HCBS, 1915(j) self-directed personal assistance services, and 1915(k) Community First Choice. CMS's HCBS quality page connects those authorities to quality measurement and quality-improvement work.
Why it matters
A caregiver-facing corpus needs one federal guidance anchor that distinguishes the Medicaid authorities behind state waiver, self-direction, and community-first-choice pathways without turning the row into eligibility advice.
198

New Jersey MLTSS and PPP home-community guidance

GuidanceNJ DMAHS home-community guidance verified July 4, 2026Pending · Activeofficial · new

New Jersey DMAHS explains MLTSS, which expands home- and community-based services through NJ FamilyCare managed care, and PPP, a self-directed personal-care option.

What changes for caregivers
DMAHS describes MLTSS as expanding home- and community-based services and coordinating long-term services and supports through NJ FamilyCare managed care, while the PPP page describes self-directed services that can let qualifying members choose workers, including trusted individuals such as friends, relatives, or neighbors.
Why it matters
This is the official guidance bridge between New Jersey's managed long-term-care model and self-directed personal care, but it should not be used as a stand-alone eligibility determination.
199

New York home-care and hospice complaint route

EnforcementNYSDOH home-care complaint route verified July 4, 2026Pending · Activeofficial · new

NYSDOH provides a Home Health Hotline and complaint route for concerns about certified home health agencies, licensed home care services agencies, and hospices.

What changes for caregivers
NYS Health Profiles and NYSDOH consumer materials direct complaints, questions, or concerns about certified home health agencies, licensed home care services agencies, and hospices to the Home Health Hotline and related complaint channels.
Why it matters
Home-care quality problems often happen outside facility settings. This row gives families the official NY complaint-route anchor while avoiding any promise that a complaint will be assigned, investigated, or resolved in a particular way.
200

New York home-care consumer and LHCSA guidance

GuidanceNYSDOH home-care guidance verified July 4, 2026Pending · Activeofficial · new

NYSDOH explains home-care options for consumers and describes licensed home care services agencies that provide nursing, home health aide, personal care, homemaker, and related support services.

What changes for caregivers
NYSDOH consumer and Health Profiles pages explain home-care agency types, complaints and questions, and licensed home care services agencies. The CDPAP page separately anchors the consumer-directed pathway for Medicaid personal assistance.
Why it matters
Caregivers need a clear map of agency home care, certified home health, and consumer-directed personal assistance before comparing programs, workers, and complaint routes.
201

Federal hospice survey and enforcement authority

EnforcementHospice survey and enforcement authority verified July 4, 2026Live · Effectiveofficial · new

Federal law and CMS survey guidance anchor hospice oversight through standard surveys, public transparency, remedies for noncompliance, and fraud-referral signals.

What changes for caregivers
42 U.S.C. 1395i-6 sets hospice survey frequency, public transparency, special-focus-program, and enforcement-remedy authority. CMS QSO-25-06-Hospice reinforces survey consistency and fraud-referral indicators, while CMS has separately ceased CY 2025 Hospice Special Focus Program implementation pending further evaluation.
Why it matters
Hospice is often delivered in the home with family caregivers as the daily safety net. The corpus needs a federal enforcement anchor for complaints, surveys, public transparency, and quality-of-care concerns without overstating the paused CY 2025 special-focus implementation.
202

Federal Medicare hospice benefit guidance

GuidanceMedicare hospice benefit guidance verified July 4, 2026Pending · Activeofficial · new

Medicare explains Part A hospice coverage, benefit periods, covered services, family respite care, costs, and hospice-provider rules for eligible beneficiaries.

What changes for caregivers
Medicare.gov explains that Part A covers hospice care when eligibility conditions are met, describes two 90-day benefit periods followed by unlimited 60-day periods, lists covered hospice services, and identifies short-term respite care for a usual caregiver. CMS's hospice provider page supplies the current provider and payment-policy anchor.
Why it matters
Hospice guidance is a high-frequency caregiver need because families must distinguish comfort-focused hospice coverage, respite, uncovered services, and provider-arranged care before a crisis.
203

Federal Medicare hospice benefit statutory authority

LegislationSocial Security Act hospice-care authority verified July 4, 2026Live · Effectiveofficial · new

Social Security Act section 1861(dd) defines Medicare hospice care and hospice program requirements, including services for terminally ill individuals and respite care.

What changes for caregivers
Section 1861(dd) defines hospice care for terminally ill individuals, including nursing care, medical social services, counseling, physicians' services, and short-term inpatient care for respite, pain control, and symptom management. It also defines hospice program requirements such as 24-hour availability and bereavement counseling for immediate family.
Why it matters
The caregiver policy corpus needs the statutory basis behind Medicare hospice guidance so summaries do not treat benefit manuals or consumer pages as the source of the underlying federal benefit.
204

New York palliative, hospice, advance-care-planning, and MOLST guidance

GuidanceNYSDOH serious-illness planning guidance verified July 4, 2026Pending · Activeofficial · new

NYSDOH publishes official guidance that separates palliative care, hospice, advance care planning, and MOLST orders for serious-illness and end-of-life planning.

What changes for caregivers
NYSDOH's Center for Hospice and Palliative Care frames hospice, palliative care, advance care planning, and MOLST as related but distinct planning paths. NYSDOH palliative care materials say palliative care can apply at any stage of serious or chronic illness, the hospice consumer page explains hospice settings and services, the advance care planning page defines written wishes for future medical care, and the MOLST page explains statewide medical orders for life-sustaining treatment.
Why it matters
Caregivers need to distinguish comfort-focused hospice, symptom-focused palliative care, future-care wishes, and portable medical orders before a hospital discharge or crisis decision.
205

Alaska Medicaid hearings and continuation-of-assistance rules

Enforcement7 AAC 49 hearings chapter verified July 4, 2026Live · Effectiveofficial · new

Alaska's public-assistance hearing regulations cover Medicaid denials, reductions, suspensions, terminations, hearing requests, representation, records access, decisions, and continuation of assistance while a hearing is pending.

What changes for caregivers
Alaska's 7 AAC 49 hearings chapter applies to Medicaid, including personal care services and home and community-based waiver services. It describes when a hearing opportunity must be granted, hearing-request timing, notice contents, records access, representation and assistance in hearings, final decisions, continuation of assistance, and retroactive assistance when the agency action was in error.
Why it matters
Caregivers often help interpret Medicaid notices, collect records, and decide whether to request review before services or coverage are interrupted. This row gives Alaska an official appeal and continuation-of-assistance anchor without giving case-specific legal advice.
206

Alaska Medicaid eligibility and coverage regulations

RegulationOfficial AAC Medicaid chapters verified July 4, 2026Live · Effectiveofficial · new

Alaska Administrative Code chapters 7 AAC 100 and 7 AAC 105-160 provide the state regulatory framework for Medicaid eligibility, applications, review applications, covered services, prior authorization, provider participation, and recipient-related coverage rules.

What changes for caregivers
Alaska's official administrative code identifies Part 7 as Medicaid Assistance Eligibility and Part 8 as Medicaid Coverage and Payment. Chapter 100 sets eligibility, application, verification, review-application, and category rules; Chapter 105 starts the coverage-and-payment framework for covered services, noncovered services, out-of-state services, prior authorization, provider participation, records, recoupment, and provider appeals.
Why it matters
Caregiver-facing Medicaid guidance needs an authority layer beneath general help pages. These chapters are the Alaska regulatory anchor for application paperwork, review cycles, coverage conditions, prior authorization, and service-payment disputes.
207

Alabama Medicaid recipient and application guidance

GuidanceRecipient and application guidance verified July 4, 2026Pending · Activeofficial · new

Alabama Medicaid's recipient and applying-for-Medicaid pages route families to eligibility categories, applications, forms, office contacts, online application paths, covered services, waivers, My Medicaid, and applicant/recipient FAQs.

What changes for caregivers
Alabama Medicaid's recipient navigation page groups applicant, recipient, program, LTC/waiver, provider, fraud, resource, and contact links. The applying FAQ explains that application routes depend on the Medicaid program; children, pregnant women, parents/caretaker relatives, and Plan First can use a paper or online application, while help paying Medicare premiums, nursing-home Medicaid, and elderly or disabled programs use district-office applications. The FAQ also explains My Medicaid status checks, waiver slots, and authorization for another person to ask about coverage and status.
Why it matters
Caregivers need an official starting point that separates online application, paper application, district-office routing, waiver wait/slot questions, and authorized-helper paperwork before they act for someone else.
208

Alabama My Medicaid portal implementation

ImplementationMy Medicaid portal functionality verified July 4, 2026Live · Implementingofficial · new

Alabama Medicaid's My Medicaid portal lets applicants and recipients check application or eligibility status, update personal information, request or print card information, view coverage details, and close an account when moving.

What changes for caregivers
Alabama Medicaid's My Medicaid FAQ says the portal is for recipients or people who have applied for Alabama Medicaid services and supports application-status checks, personal-information changes, new-card requests, proof-of-eligibility printing, coverage and benefit-detail views, and account closure when moving to another state. Alabama Medicaid's launch notice describes the portal as a 24/7 recipient and applicant access path.
Why it matters
A caregiver handling paperwork often needs the operational path for status, address, card, proof, and coverage questions. This row tracks the official portal functions without treating the portal as an eligibility decision engine.
209

Alabama Medicaid statutory framework

LegislationCode of Alabama Medicaid statutory framework verified July 4, 2026Live · Effectiveofficial · new

The Code of Alabama identifies Title 22 Chapter 6 as the Medicaid Program chapter and includes statutory authority for Medicaid program appropriations, agency claims-processing contracts, and the state Medicaid program definition.

What changes for caregivers
The official Code of Alabama page identifies Chapter 6 of Title 22 as the Medicaid Program chapter. Section 22-6-1 appropriates Medicaid Title XIX program revenue, income, and receipts for operation of the program. Section 22-6-7 describes the Alabama Medicaid Agency as the single state agency responsible for administering the Alabama Medicaid Program and authorizes fiscal-intermediary contracts for receiving, processing, and paying claims. Section 40-26B-70 defines the Medicaid program as the Title XIX medical assistance program administered in Alabama by the Alabama Medicaid Agency under executive order, Chapter 6 of Title 22, and Title 560 of the Alabama Administrative Code.
Why it matters
Caregiver-facing benefits guidance needs to know which public authority owns Medicaid administration, claims processing, and statutory program structure before connecting families to applications, provider billing questions, or appeal routes.
210

Alabama Medicaid eligibility and caretaker-relative regulations

RegulationChapter 560-X-25 eligibility rules verified July 4, 2026Live · Effectiveofficial · new

Alabama Administrative Code Chapter 560-X-25 sets Medicaid eligibility rules, including applications and representatives, redeterminations, categorical criteria, institutional and HCBS-waiver income rules, and Parents and Other Caretaker Relatives coverage.

What changes for caregivers
Alabama Administrative Code Chapter 560-X-25 is the Medicaid Eligibility chapter. Rule 560-X-25-.04 defines application, representative authority, eligibility determination, redetermination at least every 12 months, and denial or termination when needed information is not provided. Rule 560-X-25-.05 covers general categorical criteria. Rule 560-X-25-.10 covers income criteria for institutional Medicaid and certain HCBS waiver programs. Rule 560-X-25-.15 defines Parents and Other Caretaker Relatives coverage, relationship and technical requirements, and transitional medical assistance rules.
Why it matters
This is the official regulatory layer behind Alabama Medicaid application, renewal, caretaker-relative coverage, institutional care, and HCBS-waiver screening. Caregivers can use it to understand the authority beneath guidance pages while still routing final eligibility questions to Alabama Medicaid.
211

Arkansas DHS Medicaid and ARKids appeal routes

EnforcementArkansas DHS appeal instructions verified July 4, 2026Pending · Activeofficial · new

Arkansas DHS explains how Medicaid and ARKids applicants, recipients, and providers can request administrative hearings for eligibility denials, payment denials, case closures, and provider claim denials.

What changes for caregivers
Arkansas DHS's File an Appeal page lists Medicaid and ARKids eligibility and payment denials, benefit case closures, and Medicaid provider claim denials as appeal situations. For a Medicaid health-care eligibility denial, DHS says the Office of Appeals and Hearings must receive the hearing request within 30 calendar days of the letter date. The page also routes Medicaid or ARKids payment denials to a written administrative-hearing request and says Medicaid Provider Fair Hearing requests must be sent to the Arkansas Department of Health within 30 calendar days of the notice of adverse action.
Why it matters
Caregivers often help read DHS notices and decide whether an appeal deadline is urgent. This row gives Arkansas an official appeal-process anchor without giving case-specific legal advice.
212

Arkansas Medicaid beneficiary and coverage guidance

GuidanceArkansas Medicaid beneficiary guidance verified July 4, 2026Pending · Activeofficial · new

Arkansas DHS beneficiary and FAQ pages explain Medicaid coverage navigation, ARHOME, claims and health-record access, MyARMedicaid, handbook/provider links, eligible groups, and application routes for Medicaid and related programs.

What changes for caregivers
Arkansas DHS's beneficiary page separates ARHOME beneficiaries from other Medicaid beneficiaries and points users to claims, health-care records, MyARMedicaid, handbook, provider-search, and primary-care-provider resources. The Medical Services FAQ describes eligible groups including parents or relative caretakers of a child with an absent, disabled, or unemployed parent and people in medical need of certain home- and community-based services. The Apply for Services page routes Medicaid, ARKids, TEFRA, and other health-care applications to Access Arkansas and separately points adults and seniors seeking home-based help to local county offices and the Choices in Living Resource Center.
Why it matters
Caregivers need an official starting point that distinguishes beneficiary navigation, eligibility-category explanation, online application routing, and long-term services contacts before helping someone apply or manage coverage.
213

Access Arkansas Medicaid application portal implementation

ImplementationAccess Arkansas Medicaid functionality verified July 4, 2026Live · Implementingofficial · new

Arkansas DHS routes Medicaid, ARKids, TEFRA, and related health-care applications through Access.Arkansas.gov and describes online features for family applications, renewals, document upload, notices, alerts, and status checks.

What changes for caregivers
Arkansas DHS's Apply for Services page says Medicaid, ARKids, TEFRA, and other health-care applications under Medicaid categories go through Access.Arkansas.gov. The page describes Access Arkansas features that let families submit a single application online, by mail, phone, or in person at local county offices; renew or update information online; upload documents; read DHS notices and set up text or email alerts; and check application or renewal status. The linked DHS launch notice similarly describes new Access.Arkansas.gov features for Medicaid applicants and beneficiaries.
Why it matters
A caregiver helping with paperwork often needs the operational route for applications, renewals, document upload, notices, and status checks. This row tracks the portal functions without treating the portal as an eligibility decision engine.
214

Arkansas Medicaid statutory authority

LegislationArkansas Medicaid statutory authority verified July 4, 2026Live · Effectiveofficial · new

Arkansas's official Medicaid provider-manual rules identify Title XIX and Arkansas Code Annotated Section 20-77-107 as authority for DHS to establish the Arkansas Medicaid Program.

What changes for caregivers
The official Code of Arkansas Rules provider-manual section on Medicaid legal basis says Title XIX created the federal-state medical assistance program commonly known as Medicaid and that Arkansas Code Annotated Section 20-77-107 authorizes the Department of Human Services to establish a Medicaid Program in Arkansas. Arkansas DHS's Medical Services FAQ also describes Act 280 of 1939 and Act 416 of 1977 as authorizing the state medical care program and vesting DHS with regulation and administration, with Arkansas Medicaid implemented January 1, 1970.
Why it matters
Caregiver-facing benefits guidance needs to know which public authority owns Medicaid administration before connecting families to application, coverage, provider, or appeal routes.
215

Arkansas Medicaid provider-manual regulations

RegulationArkansas Medicaid provider-manual rules verified July 4, 2026Live · Effectiveofficial · new

The Code of Arkansas Rules Medicaid provider manuals set general Medicaid legal basis, scope, eligibility, waiver and service coverage, EVV, appeals, and personal-care program requirements.

What changes for caregivers
Code of Arkansas Rules Section I All Provider Manuals sets general Medicaid program policy, including legal basis, scope, beneficiary eligibility and aid categories, provider participation, ARChoices and TEFRA summaries, electronic visit verification for in-home personal care, attendant care, respite, and home health services paid by Medicaid, and administrative reconsideration and appeal provisions. The Personal Care Section II manual covers personal-care provider participation, IndependentChoices, program authority and purpose, eligible individuals, personal-care service locations, ARChoices person-centered service-plan authorization, individualized service plans, aide qualifications, prior authorization, and appeals.
Why it matters
This is the official regulatory layer behind Arkansas Medicaid coverage, home- and community-based care pathways, personal care, self-direction references, EVV, and appeal mechanics. Caregivers can use it to understand the authority beneath guidance pages while routing final eligibility and service questions to Arkansas DHS.
216

Arizona AHCCCS grievance and appeal routes

EnforcementAHCCCS grievance and appeal guidance verified July 4, 2026Pending · Activeofficial · new

Arizona AHCCCS explains grievance, appeal, expedited appeal, continued-services, and State Fair Hearing routes for applicants, enrolled members, fee-for-service members, and authorized representatives.

What changes for caregivers
AHCCCS says applicants, members, and authorized representatives may file grievances or appeals. The page distinguishes applicant appeals, SMI appeals, health-plan member grievances and appeals, fee-for-service and American Indian Health Plan appeals, expedited appeal requests when waiting 30 days could seriously jeopardize health, continued-services requests when services or benefits are reduced, suspended, or terminated, and State Fair Hearing requests after unfavorable appeal decisions. Arizona Administrative Code Chapter 34 separately establishes the AHCCCS grievance system, including eligibility hearings, enrolled-person appeals, fee-for-service appeals, claim disputes, and the 30-day time frame for requesting a State Fair Hearing after receipt of a notice of adverse action.
Why it matters
Caregivers often help read notices, contact health plans, preserve services during an appeal, and decide whether a hearing deadline is urgent. This row gives Arizona an official appeal-process anchor without giving case-specific legal advice.
217

Arizona AHCCCS member and ALTCS coverage guidance

GuidanceAHCCCS coverage guidance verified July 4, 2026Pending · Activeofficial · new

Arizona AHCCCS member pages explain who can apply, covered services, health-plan routing, ALTCS long-term care coverage, in-home services, member-directed options, and difficulty-of-care income treatment.

What changes for caregivers
AHCCCS's Who Can Apply page says AHCCCS offers medical programs and resources for Arizona residents who meet income and other requirements and routes users by category, including children, adults, people age 65 or older, people who are blind or disabled, people with developmental disabilities needing long-term care, pregnant people, and working individuals with disabilities. The Covered Services page explains that AHCCCS contracts with health plans and ALTCS program contractors; ALTCS members are assigned a case manager, may receive long-term care services such as home health services, and may use member-directed options for attendant care, personal care, and homemaker services when living in their own home. The ALTCS page says ALTCS services may be provided in an institution or a home or community-based setting and that many ALTCS members live in their own homes or assisted living facilities and receive needed in-home services.
Why it matters
Caregivers need an official starting point that separates AHCCCS eligibility categories, covered services, health-plan routing, ALTCS long-term care, member-directed options, and difficulty-of-care income questions before helping someone apply or manage coverage.
218

Health-e-Arizona Plus AHCCCS application and renewal implementation

ImplementationHealth-e-Arizona Plus functionality verified July 4, 2026Live · Implementingofficial · new

Arizona AHCCCS routes online medical-assistance applications, ALTCS registration, renewals, notices, alerts, change reporting, application status, and account management through Health-e-Arizona Plus.

What changes for caregivers
AHCCCS's application page says people can apply online for AHCCCS Medical Assistance, Nutrition Assistance, and Cash Assistance using Health-e-Arizona Plus and can apply for themselves, family, or someone close to them. It also explains Community Assistor organizations, print-application routes, ALTCS online registration through a HEAplus account, and application processing periods. AHCCCS's renewing and reporting page says eligibility renewal is completed every 12 months and that a Health-e-Arizona Plus account can be used to see benefit letters, stop paper letters, set text or email alerts, report address and other changes, see application status, renew benefits and coverage, and manage an account.
Why it matters
A caregiver helping with paperwork often needs the operational route for applications, renewals, notices, status checks, change reports, and ALTCS registration. This row tracks the official portal functions without treating the portal as an eligibility decision engine.
219

Arizona AHCCCS statutory framework

LegislationArizona AHCCCS statutes verified July 4, 2026Live · Effectiveofficial · new

Arizona Revised Statutes Title 36 Chapter 29 establishes the Arizona Health Care Cost Containment System and sets statutory duties for applications, eligibility processes, appeals, covered services, health-plan contracts, and long-term care.

What changes for caregivers
Arizona Revised Statutes Section 36-2903 establishes the Arizona health care cost containment system and assigns administration duties including access planning, contractor oversight, quality assurance, fraud prevention, coordination of benefits, enrollment, claims resolution, and rules for transitions and county long-term care requests. Section 36-2903.01 directs uniform application forms, streamlined eligibility, expedited eligibility and enrollment for hospitalized applicants, eligibility appeals, hearing processes, federal funding, covered-service rules, and cost-sharing authority. Section 36-2904 governs prepaid capitation coverage, contractor assignment, services before enrollment for determined-eligible people, health-plan contracts, claims timing, primary care, and member notification of family-planning services. AHCCCS's Title 36 Chapter 29 index identifies the chapter's articles, including AHCCCS, ALTCS, Qualified Medicare Beneficiary, Children's Health Insurance Program, and Comprehensive Care for the Elderly Program.
Why it matters
Caregiver-facing benefits guidance needs to know which public authority owns AHCCCS administration, eligibility, health-plan routing, appeals, covered services, and long-term care before connecting families to applications, notices, providers, or appeal routes.
220

Arizona AHCCCS Title 9 regulations

RegulationArizona AHCCCS Title 9 rules verified July 4, 2026Live · Effectiveofficial · new

Arizona Administrative Code Title 9 includes AHCCCS administration, Arizona Long-Term Care System, and grievance-system chapters governing covered services, ALTCS, eligibility hearings, appeals, claim disputes, and State Fair Hearing processes.

What changes for caregivers
AHCCCS's Administrative Code page says the Arizona Administrative Code is the official collection of rules governing state agencies and that AHCCCS rules are in Title 9, including Chapter 22 for AHCCCS administration, Chapter 28 for the Arizona Long-Term Care System, Chapter 29 for Medicare cost sharing, Chapter 31 for the Children's Health Insurance Program, and Chapter 34 for the grievance system. The Secretary of State's Chapter 22 PDF identifies the chapter as AHCCCS Administration under authority of A.R.S. Section 36-2901 et seq. and includes articles for scope of services, covered services, and eligibility coverage groups. Chapter 28 is the Arizona Long-Term Care System chapter. Chapter 34 establishes eligibility-hearing, enrolled-person appeal, fee-for-service appeal, claim-dispute, and State Fair Hearing rules.
Why it matters
This is the official regulatory layer beneath Arizona AHCCCS benefits guidance, covered services, ALTCS long-term care, application/eligibility hearing routes, member appeals, and provider claim disputes.
221

California Medi-Cal fair hearing and aid-paid-pending routes

EnforcementCalifornia Medi-Cal hearing guidance verified July 4, 2026Pending · Activeofficial · new

California DHCS explains Medi-Cal hearing requests, 90-day filing timing, aid paid pending, discrimination complaints, and managed-care hearing rights for people whose benefits or services are denied, changed, delayed, or reduced.

What changes for caregivers
DHCS says Medi-Cal applicants, recipients, and current beneficiaries with complaints about how benefits or services were handled, denied, or modified may talk with the county, file a discrimination complaint, or request a hearing. The page says a hearing request generally must be filed within 90 days of receiving a Notice of Action and that benefits may continue pending review when aid-paid-pending timing is met. Welfare and Institutions Code Section 10950 gives applicants and recipients an opportunity for a state hearing when dissatisfied with county action, delay, or refusal to accept an application, and defines Medi-Cal managed-care adverse benefit determinations. California's official regulations index includes State Administrative Hearings under Title 22, Chapter 2 and the medical-assistance-pending-hearing rule under Title 22, Chapter 3, Article 1.3.
Why it matters
Caregivers often help interpret notices, preserve services during a dispute, collect records, and request hearings on time. This row gives California an official appeal and hearing anchor without giving case-specific legal advice.
222

California Medi-Cal member benefits and coverage guidance

GuidanceCalifornia Medi-Cal member guidance verified July 4, 2026Pending · Activeofficial · new

California DHCS member pages explain Medi-Cal basics, benefits, application routes, county offices, managed-care resources, dental, transportation, in-home care, HCBS, and other program resources.

What changes for caregivers
DHCS's Medi-Cal landing page describes Medi-Cal as free or low-cost health coverage for people who qualify and routes members to benefits, qualification, application, use, renewal, help, and contact pages. DHCS benefit pages list covered categories such as doctor care, hospital and clinic visits, dental and vision, medications, emergency care, laboratory services, rehab, mental health and substance-use services, transportation, and wellness care. DHCS's myMedi-Cal page says the guide explains how to apply, use benefits, and report changes, and links to county offices, Health Care Options, transportation, Medi-Cal Dental, IHSS, fair-hearing, and other program resources. DHCS's Help page explains that DHCS oversees Medi-Cal, county offices manage most cases, and the Benefits section includes essential health benefits, in-home care, transportation, and home- and community-based services.
Why it matters
Caregivers need an official California navigation layer for benefits, county routing, managed-care choices, transportation, dental, in-home supports, and HCBS before helping someone apply, renew, call a plan, or escalate a coverage problem.
223

California Medi-Cal statutory framework

LegislationCalifornia Medi-Cal statutes verified July 4, 2026Live · Effectiveofficial · new

California Welfare and Institutions Code provisions establish Medi-Cal's purpose, covered benefits schedule, state-hearing rights, managed-care adverse-benefit determinations, and related eligibility-redetermination protections.

What changes for caregivers
Welfare and Institutions Code Section 14000 states the purpose of the Basic Health Care chapter: to afford qualifying individuals health care and related remedial or preventive services, including necessary related social services, and to provide health care for California residents who lack sufficient income to meet health-care costs. Section 14132 sets the Medi-Cal schedule of benefits, including outpatient services, inpatient hospital services, nursing-facility services, home health care, medical transportation, home- and community-based services, hospice, nonmedical transportation, and other covered categories. Section 10950 gives applicants and recipients state-hearing rights and defines managed-care adverse benefit determinations. Section 14005.37 requires 12-month redeterminations and continuation of Medi-Cal eligibility during the redetermination process until a specific determination and due process requirements are met.
Why it matters
Caregiver-facing California benefits guidance needs to know the statute-level authority for covered services, home/community supports, hearing rights, managed-care adverse benefit determinations, and renewal protections before connecting families to program guidance or appeals.
224

California Medi-Cal Title 22 regulations

RegulationCalifornia Medi-Cal Title 22 rules verified July 4, 2026Live · Effectiveofficial · new

California Code of Regulations Title 22 organizes Medi-Cal eligibility, share of cost, application processing, state administrative hearings, general medical-assistance provisions, and scope and duration of benefits.

What changes for caregivers
California's official regulations index places Medi-Cal rules in Title 22, Division 3, Subdivision 1, California Medical Assistance Program. Chapter 2 is Determination of Medi-Cal Eligibility and Share of Cost and includes articles on beneficiary application process, Medi-Cal programs, state administrative hearings, and estate recovery. Chapter 3, Article 1.3 includes general provisions such as beneficiary billing, treatment authorization requests, discrimination, fair hearing related to denial, termination, or reduction in medical services, medical assistance pending fair hearing decision, and provider grievance provisions. Chapter 3, Article 4 is Scope and Duration of Benefits and lists benefit sections including schedule of benefits, physician services, drugs, transportation, nursing-facility services, home health, EPSDT, home and community-based waiver services, hospice, and personal care services. Section 51301 states that benefits covered by Medi-Cal are limited to those set forth in Article 4 and Chapter 5, Article 4.
Why it matters
This is the official regulatory layer beneath California Medi-Cal applications, eligibility, hearings, coverage limits, medical-service continuation questions, provider billing, and home/community benefit categories.
225

Colorado Health First Colorado appeal and hearing routes

EnforcementHealth First Colorado appeal guidance verified July 4, 2026Pending · Activeofficial · new

Colorado Health First Colorado explains eligibility appeals, benefit and service appeals, state fair hearings, expedited appeals, representation, help contacts, and continuation of coverage or services for some timely appeals.

What changes for caregivers
Health First Colorado says members and applicants generally have 60 days from a Notice of Action to ask for a state fair hearing. The appeal page distinguishes eligibility appeals, benefits and services appeals, health-plan appeals, expedited appeals when waiting may put life or health at risk, informal meetings, representation, evidence, initial decisions, written exceptions, final agency decisions, and help contacts. It also explains that current members may keep coverage or previously authorized services during some appeals when the Office of Administrative Courts or the health plan receives the continuation request within the listed 10-day timing.
Why it matters
Caregivers often help read notices, preserve services, collect evidence, coordinate with health plans, and decide whether a hearing deadline is urgent. This row gives Colorado an official appeal-process anchor without giving case-specific legal advice.
226

Colorado Health First Colorado benefits and member guidance

GuidanceColorado member guidance verified July 4, 2026Pending · Activeofficial · new

Colorado's official Health First Colorado member pages and handbook explain covered benefit categories, member contacts, regional organizations, nurse advice, claims data, transportation, appeals, and ways to get help using coverage.

What changes for caregivers
Health First Colorado's Benefits & Services page lists common covered benefit categories and routes members to the Member Handbook for details. The handbook describes coverage and points members to the Member Contact Center. HCPF's member FAQs and Health First Colorado help pages route members to regional organizations, managed care plans, county human services offices, PEAK, the mobile app, and other official help points.
Why it matters
Caregivers need an official Colorado navigation layer for covered benefit categories, member handbook details, regional organization routing, contact-center help, nurse advice, transportation, and appeal links before helping someone apply, renew, call a plan, or escalate a coverage problem.
227

Colorado PEAK and Health First Colorado application and renewal implementation

ImplementationColorado PEAK and renewal operations verified July 4, 2026Live · Implementingofficial · new

Colorado routes Health First Colorado applications, paper forms, phone applications, county-office help, application status, renewals, change reporting, PEAK mailbox notices, and mobile-app functions through PEAK, Health First Colorado pages, HCPF forms, counties, and assistance sites.

What changes for caregivers
Health First Colorado says PEAK is the fastest way to apply, that most people find out right away if they qualify, and that application status can be checked online. The Apply Now page also lists phone, mail, and in-person application routes. HCPF's forms page provides Health First Colorado and CHP+ paper applications, combined Health First Colorado/CHP+/cash/food assistance forms, disability applications, identity forms, and former foster-care youth forms. The renewals page explains annual renewals, renewal packets sent by mail and through PEAK about 60 to 70 days before the renewal deadline, online completion through PEAK or the mobile app, and county mail, fax, or in-person return routes.
Why it matters
A caregiver helping with paperwork often needs the operational route for applications, renewals, notices, status checks, change reports, paper forms, document upload, phone fallback, and county-office fallback. This row tracks the official portal and paperwork functions without treating PEAK as an eligibility decision engine.
228

Colorado Medical Assistance statutory framework

LegislationColorado Title 25.5 statutes verified July 4, 2026Live · Effectiveofficial · new

Colorado Revised Statutes Title 25.5 establishes the Department of Health Care Policy and Financing framework, defines medical assistance and members, assigns administration of the Colorado Medical Assistance Act, and authorizes the state medical assistance program.

What changes for caregivers
Colorado Revised Statutes Title 25.5 defines medical assistance to include programs administered by the state department, including the Colorado Medical Assistance Act in articles 4, 5, and 6. It defines a member as a person determined eligible to receive benefits or services under Title 25.5, directs the Department of Health Care Policy and Financing to administer the Colorado Medical Assistance Act, and provides that the state department, by rules, establishes the medical assistance program as the single state agency under Title XIX.
Why it matters
Caregiver-facing benefits guidance needs to know which public authority owns Colorado Medicaid administration, eligibility, coverage, hearing routes, and program rules before connecting families to applications, notices, providers, or appeal routes.
229

Colorado Medical Assistance 10 CCR 2505-10 regulations

RegulationColorado Medical Assistance rules verified July 4, 2026Live · Effectiveofficial · new

Colorado Secretary of State rules organize Medical Assistance regulations for eligibility, provider screening, covered services, managed care, long-term care, home health, hospice, durable medical equipment, case management, and home- and community-based services.

What changes for caregivers
Colorado's official Code of Colorado Regulations document list places Medical Assistance rules in 10 CCR 2505-10. The listed sections include eligibility, provider screening and NPI; physician, dental, vision, Medicaid managed care, and EPSDT services; hospital services; long-term care, nursing facility care, and adult day care; home health, hospice, oxygen, and durable medical equipment; case management; pharmaceuticals; and home- and community-based services. The Secretary of State rule pages identify the CCR as the official publication of state administrative rules and list current effective rule versions for 8.100 eligibility and 8.7000 home and community-based services.
Why it matters
This is the official regulatory layer beneath Colorado Health First Colorado applications, eligibility, covered services, long-term care, home/community supports, managed care, provider participation, and service-rule explainers.
230

Connecticut DSS HUSKY hearing and continuation routes

EnforcementConnecticut DSS hearing routes verified July 4, 2026Pending · Activeofficial · new

Connecticut DSS explains who may request a hearing on DSS benefit actions, how to request one, general request timing, Medicaid/HUSKY continuation timing, and nursing-facility transfer, discharge, and readmission hearing timing.

What changes for caregivers
DSS's Office of Legal Counsel, Regulations and Administrative Hearings says DSS benefit applicants or recipients, authorized or legal representatives, certain family members, Medicaid community spouses or representatives, people liable for a deceased person's medical debts that could be covered by Medicaid, and nursing-facility residents in specified transfer, discharge, or readmission situations may request hearings. DSS identifies the Notice of Action hearing form as the best route, allows a signed explanatory letter, generally sets a 60-day hearing-request window for non-SNAP DSS programs, and states that Medicaid/HUSKY benefits may continue if the hearing request is made before the proposed action date. The same page gives separate nursing-facility transfer, discharge, and failure-to-readmit timing and cites Connecticut statutes and federal SNAP hearing rules.
Why it matters
Caregivers often help interpret benefit notices, gather documents, preserve services while a decision is reviewed, or respond to nursing-facility transfer and discharge notices. This row anchors Connecticut hearing triage in DSS instructions without turning it into case-specific legal advice.
231

Connecticut HUSKY Health benefits and member guidance

GuidanceConnecticut HUSKY member guidance verified July 4, 2026Pending · Activeofficial · new

Connecticut's HUSKY Health and DSS pages explain Medicaid and CHIP program categories, covered benefit categories, member handbooks, benefit grids, Quick Guides, member support, care-management links, and home- and community-based service routes.

What changes for caregivers
The official HUSKY gateway identifies HUSKY Health as Connecticut Medicaid and CHIP coverage for children and adults, including children, parents, relative caregivers, elders, individuals with disabilities, adults without dependent children, and pregnant women. DSS's healthcare page says HUSKY Health encompasses Medicaid and CHIP, lists HUSKY A, B, C, and D categories, and points members to handbooks, care management, provider information, state plan amendments, waivers, application routes, and benefits overview pages. The benefit overview lists common covered categories such as preventive care, doctor visits, long-term services and supports, home health care, hospice, dental, behavioral health, pharmacy, and non-emergency transportation for HUSKY A, C, and D members. HUSKY Health member pages provide handbooks, benefit grids, Quick Guides, program identification on the member ID card, and Member Engagement Services contact routes. DSS's HCBS page lists state-plan and waiver community options, including Community First Choice, CHCPE, Katie Beckett, Money Follows the Person, PCA Waiver, and DDS waivers.
Why it matters
Caregivers need a trusted Connecticut navigation layer for what HUSKY category a person is in, where to find benefit details, which member handbook or guide applies, and which official path handles medical, dental, behavioral health, pharmacy, transportation, long-term services, or HCBS questions.
232

Connecticut medical assistance statutory framework

LegislationConnecticut medical assistance statutes verified July 4, 2026Live · Effectiveofficial · new

Connecticut statutes identify the Department of Social Services as the state agency administering Medicaid, place medical assistance in Chapter 319v, and define major HUSKY and Medicaid eligibility authorities that underlie Connecticut benefit navigation.

What changes for caregivers
Connecticut General Statutes Chapter 319o establishes DSS and designates DSS as the state agency for programs including Medicaid under Title XIX. Chapter 319v is the Medical Assistance chapter, includes Sec. 17b-260 authorizing the DSS commissioner to use and administer Title XIX medical assistance programs, and includes Sec. 17b-261 on Medicaid eligibility, assets, waivers, and state-funded medical assistance for children regardless of immigration status. DSS's healthcare page connects that statutory layer to the current public-facing HUSKY Health categories and says HUSKY Health encompasses Medicaid and CHIP.
Why it matters
Caregiver-facing benefit explainers need a clear Connecticut authority anchor before translating application, eligibility, appeal, coverage, HUSKY category, long-term services, or provider-rule questions into official next steps.
233

Connecticut Medical Assistance Program regulations and provider manuals

RegulationConnecticut CMAP regulatory materials verified July 4, 2026Live · Effectiveofficial · new

Connecticut's Medical Assistance Program portal and eRegulations pages provide the provider-facing rule and manual layer for enrollment, client eligibility, specific policy and regulation, prior authorization, claims, program bulletins, and HUSKY/Medicaid definitions.

What changes for caregivers
The Connecticut Medical Assistance Program portal says it is provided by Gainwell Technologies on behalf of Connecticut DSS and contains resources for providers including enrollment, billing manuals, bulletins, program regulations, Electronic Data Interchange, and the Automated Eligibility Verification System. The Publications page lists provider manual chapters for provider participation, enrollment and re-enrollment, client eligibility, claim submission, EDI, specific policy/regulation, prior authorization, web portal/AVRS, and claim resolution, with provider types including CT Home Care Program, Community First Choice, home health, hospice, nursing facilities, personal care assistance, and transportation. CT's eRegulations section 17b-262-913 defines HUSKY A, HUSKY C, HUSKY D, Medicaid, prior authorization, state plan, and utilization management for the cited DSS regulations.
Why it matters
Coverage, prior authorization, provider participation, claims, and service-access friction often surface through provider-facing rules before a caregiver ever sees a plain-language notice. This row anchors Connecticut's regulatory/manual layer for later, narrower service-specific explainers.
234

District of Columbia Medicaid fair hearing and continuation routes

EnforcementDC Medicaid hearing routes verified July 4, 2026Live · Effectiveofficial · new

DC DHCF explains that Medicaid beneficiaries and EPD Waiver participants may request a Fair Hearing through the DC Office of Administrative Hearings when Medicaid denies, reduces, suspends, or stops a service or item, and identifies continuation, reconsideration, representation, accommodation, interpreter, and document-access rights.

What changes for caregivers
DHCF's Fair Hearing page says beneficiaries have a right to request a Fair Hearing with the DC Office of Administrative Hearings if Medicaid was wrong in denying, reducing, suspending, or stopping a service or item. The page says a hearing may be requested no more than ninety days from the postmark of the adverse letter, continuation of benefits requires requesting the Fair Hearing before the 30-day notice ends, reconsideration may be requested within 21 days for level-of-care assessments, and a beneficiary may be represented by a family caregiver, lawyer, or other representative. DHCF's Medicaid page separately points SSI-linked Medicaid eligibility hearings to the Social Security Administration, and the DC Medicaid State Plan Section 4 indexes hearings for applicants and recipients.
Why it matters
Caregivers often need to preserve services while a denial, reduction, suspension, or termination is reviewed. This row anchors the DC Benefits & Coverage enforcement path without converting it into case-specific legal advice.
235

District of Columbia Medicaid and health coverage member guidance

GuidanceDC Medicaid member guidance verified July 4, 2026Live · Effectiveofficial · new

DC DHCF's coverage and service-navigation pages describe Medicaid, DC Healthy Families, the Health Care Alliance, CASSIP, fee-for-service and managed-care pathways, managed-care plan options, and EPD Waiver service categories relevant to family caregivers.

What changes for caregivers
DHCF's District Health Care Coverage page describes DC Medicaid as a federal/state program run by DHCF for low-income, disabled, and family populations, identifies DC Healthy Families coverage examples such as doctor visits, vision and dental care, prescription drugs, hospital stays, and transportation, describes Health Care Alliance and CASSIP, and names CASSIP's specialty-care and long-term-services-and-supports coverage. DHCF's service-navigation page distinguishes fee-for-service Medicaid from managed care, notes common fee-for-service populations including people 65 or older, people with disabilities, and people receiving long-term care services, and says managed care can help coordinate care. DHCF's MCP page identifies the District's contracted managed-care plans, while the EPD Waiver page lists services including adult day health, assisted living, case management, chore aide, community transition, homemaker, participant-directed Services My Way, personal care aide, personal emergency response, and respite.
Why it matters
This is the DC member-facing guidance anchor for caregiver questions about coverage categories, plan navigation, long-term services, transportation, waiver services, and where a family should start before a narrower program page is promoted.
236

District of Columbia District Direct Medicaid application and renewal implementation

ImplementationDistrict Direct and renewal operations verified July 4, 2026Live · Effectiveofficial · new

DC DHCF directs residents to District Direct and other submission channels for Medicaid, Alliance, and Immigrant Children's Program applications, renewals, changes, verifications, document uploads, and benefit-account management.

What changes for caregivers
DHCF's application page says residents can apply for DC Medicaid, DC Alliance, and the Immigrant Children's Program in multiple ways, that in-person interviews are not required for Medicaid or Alliance/ICP, and that District Direct can be used to submit applications, renewals, changes, or verifications. DHCF's renewal page distinguishes passive from non-passive renewals, says renewal forms may be sent by mail and available in District Direct, identifies MAGI and non-MAGI renewal notice timelines, and lists online, mobile-app, phone, mail, and fax submission routes plus the District Direct Partner Portal for nursing facility and waiver renewals. DHCF's District Direct training says the portal lets beneficiaries apply and manage medical assistance, check eligibility, renew or recertify benefits, report changes, upload documents, and request a new Medicaid card.
Why it matters
Coverage retention often fails at paperwork, notices, accounts, and renewal routing. This row anchors the DC implementation layer for caregiver-facing renewal and application workflows.
237

District of Columbia medical assistance statutory framework

LegislationDC medical assistance statutes verified July 4, 2026Live · Effectiveofficial · new

The D.C. Code establishes the District's Title XIX medical assistance authority, Medicaid benefit provisions, medical-assistance expansion authority, and reasonable-promptness application-processing requirements.

What changes for caregivers
D.C. Code § 1-307.02 authorizes the Mayor to submit a Title XIX medical assistance plan and modifications so the District can receive federal financial assistance for a medical assistance program established under that plan. D.C. Code § 4-204.05 requires the District state plan under Title XIX to provide that listed categories are eligible for full Medicaid benefits. D.C. Code § 1-307.03 authorizes a medical-assistance expansion program for adult District residents up to a statutory income threshold and allows implementation through managed care or fee-for-service arrangements, waivers, and state plan amendments. D.C. Code § 4-205.26 requires public and medical assistance applications to be approved or disapproved with reasonable promptness and sets application-processing timeframes subject to specified delays.
Why it matters
Caregiver-facing explainers need a DC statutory anchor before translating Medicaid, expansion coverage, application timing, and state-plan questions into operational guidance.
238

District of Columbia Medicaid regulations, state plan, and provider materials

RegulationDC Medicaid regulatory materials verified July 4, 2026Live · Effectiveofficial · new

DC DHCF publishes Medicaid regulation notices, the Medicaid State Plan, Medicaid updates, provider information, and State Plan administration sections that govern hearings, records, quality control, program manuals, provider agreements, utilization review, cost sharing, payment, and related coverage operations.

What changes for caregivers
DHCF's Medicaid Regulations page lists official rulemaking notices, including the 2026 beneficiary reimbursement final rulemaking, 2021 long-term care services and support assessment and personal care aide reimbursement rulemakings, and rulemakings for HCBS waivers, provider screening, managed-care enrollment and disenrollment, telemedicine, adult hospice, adult day health, health homes, nursing facilities, personal care, respite, and related services. DHCF's provider information page links Medicaid Director Letters, the Medicaid State Plan, DHCF Medicaid Regulations, DHCF Medicaid Updates, behavioral health integration, and high-cost curative therapy. DHCF's State Plan Section 4 page indexes program administration materials including hearings for applicants and recipients, safeguarding information, Medicaid quality control, fraud detection and investigation, program manuals, free choice of providers, required provider agreements, utilization/quality control, inspections, liens and recoveries, cost sharing, and payment.
Why it matters
Coverage, provider participation, reimbursement, utilization review, hearings, and long-term-care operations often turn on regulatory and state-plan materials before they appear in a consumer-facing notice. This row anchors the DC regulatory layer for later service-specific explainers.
239

Delaware Medicaid fair hearing and managed-care appeal routes

EnforcementDelaware Medicaid fair-hearing routes verified July 4, 2026Live · Effectiveofficial · new

Delaware DSSM fair-hearing rules and DMMA rulemaking materials identify fair-hearing rights for DSS and DMMA applicants and recipients, notice and continuation rules, managed-care hearing routes after MCO appeal resolution or failure, HCBS hearing jurisdiction, and oral, written, telephonic, and online request options.

What changes for caregivers
Delaware DSSM 5000 describes the opportunity for a fair hearing for people dissatisfied with DSS or DMMA decisions, the content of adequate and timely notices, expedited fair hearings for medical assistance when standard timing could jeopardize health or function, continuation of assistance during timely hearing requests, managed-care hearing jurisdiction after MCO appeal resolution or failure to follow appeal requirements, and HCBS hearing jurisdiction. A June 2024 Delaware Register final rule amended the Medicaid fair-hearing process to support oral, written, telephonic, and online medical-assistance hearing requests and made those changes effective June 11, 2024. DHSS's Diamond State Health Plan materials provide the managed-care context for Medicaid members.
Why it matters
Caregivers often help preserve Medicaid, HCBS, and managed-care services while a denial, reduction, suspension, or termination is reviewed. This row anchors Delaware hearing triage in official DSSM, rulemaking, and DHSS sources without giving case-specific legal advice.
240

Delaware Diamond State Health Plan member guidance

GuidanceDelaware Medicaid member guidance verified July 4, 2026Live · Effectiveofficial · new

Delaware DHSS and DMMA guidance explains Diamond State Health Plan and DSHP Plus managed care, MCO choice, Medicaid-covered pharmacy and non-emergency transportation carve-outs, populations not enrolled in MCOs, Medicaid program menus, long-term home and community-based services, Lifespan Waiver services, and state-plan service attachments.

What changes for caregivers
DHSS says most Medicaid benefits are delivered through Diamond State Health Plan managed-care organizations under contract with the state, while prescription benefits and non-emergency transportation are covered directly by Medicaid instead of the MCO. DHSS identifies MCO choice and assignment rules, categories of people not enrolled in MCOs, and the Section 1115 waiver context for DSHP. DHSS eligibility, HCBS, and forms/publications pages identify Medicaid program categories, long-term HCBS options that help people remain at home or in assisted living instead of a nursing facility, Lifespan Waiver community alternatives, and Medicaid State Plan attachments for services and eligibility.
Why it matters
Caregivers need a single Delaware orientation layer before drilling into plan choice, carved-out benefits, HCBS service categories, waiver services, transportation, or state-plan coverage. This row marks the official member-guidance surface for later service-specific explainers.
241

Delaware ASSIST Medicaid application and renewal implementation

ImplementationDelaware Medicaid application and renewal workflow verified July 4, 2026Live · Effectiveofficial · new

Delaware ASSIST and DSSM Medicaid eligibility rules document the online application and account workflow for Medicaid and related health programs, including finishing applications, checking status, viewing notices, reporting changes, renewing benefits, application assistance modes, filing protections, determination timing, annual renewal, ex parte renewal, prepopulated renewal forms, and reconsideration after renewal response windows.

What changes for caregivers
Delaware ASSIST identifies itself as the online application for Delaware health and social-service programs and lists account actions including finishing applications, checking status, viewing notices, reporting changes, and renewing benefits. DSSM 14000 describes general Medicaid eligibility requirements, assistance channels for applications, protected filing-date rules, no interview for MAGI and long-term-care determinations, timely determination standards, annual renewal, ex parte renewal when possible, ASSIST/phone/mail/in-person/electronic reporting options, prepopulated renewal forms, a 30-day renewal response period, and a 90-day reconsideration period after renewal closure. DHSS forms and publications link Medicaid application materials and state-plan application and renewal sections.
Why it matters
A large share of caregiver benefit work is operational: applying, uploading or reporting information, watching notices, renewing coverage, and avoiding avoidable churn. This row anchors Delaware's application and renewal workflow in official portal and DSSM materials.
242

Delaware medical assistance statutory framework

LegislationDelaware medical assistance statutes verified July 4, 2026Live · Effectiveofficial · new

Delaware Code Title 31 Chapter 5 defines assistance, medical assistance, and medical care; authorizes medical assistance for eligible people under federal Social Security Act titles, waivers, and DHSS rules and regulations; and ties eligibility and payment to DHSS policies, regulations, state and federal mandates, funding, and waivers.

What changes for caregivers
Delaware Code Title 31 Chapter 5 states the public-assistance purpose, defines assistance and medical assistance, and defines medical care to include inpatient and outpatient services, lab and x-ray services, nursing services, physician and pharmacist services, drugs, and other health services and supplies under standards prescribed by statute or regulation. Section 503(b) authorizes medical assistance for people eligible under specified federal titles, waivers, and DHSS rules and regulations, with eligibility and payment determined under DHSS policies and state and federal mandates, funding, and waivers. Section 505 identifies Medicaid assistance as a category of assistance for medical care, including dental care, for eligible individuals under the federal Social Security Act, waivers, and DHSS rules and regulations.
Why it matters
The Delaware statutory layer determines the authority underneath Medicaid eligibility, covered medical care, DHSS rulemaking, and waiver implementation. This row gives later Delaware coverage explainers a legal-authority anchor.
243

Delaware Medicaid regulations, state plan, and provider materials

RegulationDelaware Medicaid regulatory materials verified July 4, 2026Live · Effectiveofficial · new

Delaware Medicaid regulatory and operating materials include DSSM Medicaid eligibility and fair-hearing rules, Medicaid State Plan sections and attachments for eligibility, services, administration, reimbursement, quality, third-party liability, advance directives, nursing-facility compliance, and provider portal or manual materials used by participating providers.

What changes for caregivers
DSSM 14000 describes Medicaid eligibility administration, determination, renewal, and fair-hearing cross-references, while DSSM 5000 governs fair-hearing practice and procedures. DHSS forms and publications link the Delaware Medicaid State Plan and sections covering MAGI eligibility and benefits, application and renewal methods, eligibility groups, income and resource requirements, amount, duration, and scope of services, transportation, 1915(i) HCBS, reimbursement, quality, civil rights, payments, provider-preventable conditions, rates, third-party liability, advance directives, and nursing-facility compliance. Delaware's Medicaid provider portal and publication materials support provider eligibility checks, claims, provider updates, secure messaging, and current manuals or policy communications.
Why it matters
Coverage, eligibility, reimbursement, provider participation, hearings, claims, and long-term-care operations often depend on regulatory, state-plan, and provider-manual material rather than a single consumer page. This row anchors Delaware's regulatory layer for later service and provider-operation explainers.
244

Florida Medicaid fair hearing and public-assistance appeal routes

EnforcementFlorida Medicaid hearing routes verified July 4, 2026Live · Effectiveofficial · new

Florida AHCA and DCF official materials identify Medicaid fair-hearing routes for denied, reduced, suspended, or stopped Medicaid services, managed-care plan appeal exhaustion before some fair hearings, legal or authorized representative access, DCF public-assistance hearings for Medicaid eligibility actions, and Rule 59G-1.100 procedures for AHCA Medicaid fair hearings.

What changes for caregivers
AHCA says a Medicaid Fair Hearing may be available when a Medicaid service is denied, reduced, or stopped; managed-care enrollees generally must complete the plan appeal process before requesting a Medicaid Fair Hearing; and requests may be made through the Medicaid Helpline or in writing. AHCA's complaint-or-hearing page says only the recipient or legal/authorized representative can request a hearing. DCF conducts public-assistance fair hearings for applicants and recipients, including Medicaid eligibility actions, and says SNAP, cash assistance, and Medicaid fair hearings generally must be requested within 90 days of the Notice of Case Action. Florida Administrative Code Rule 59G-1.100 establishes AHCA Medicaid fair-hearing jurisdiction, parties, authorized representative rules, plan-appeal prerequisites, and case-file access.
Why it matters
Caregivers often need to distinguish eligibility appeals handled through DCF from service, SMMC, or plan-related fair hearings handled through AHCA. This row anchors Florida hearing triage in official state sources without converting it into case-specific legal advice.
245

Florida Statewide Medicaid Managed Care member guidance

GuidanceFlorida Medicaid member guidance verified July 4, 2026Live · Effectiveofficial · new

Florida AHCA guidance explains that Medicaid is administered by AHCA, most recipients are enrolled in Statewide Medicaid Managed Care, SMMC includes Long-Term Care, Managed Medical Assistance, and Dental components, SMMC 3.0 began on February 1, 2025, covered-service and HCBS-waiver pages list service overviews, and the LTC program uses AHCA, DCF, and DOEA roles for coverage policy, financial eligibility, medical eligibility, and level-of-care determinations.

What changes for caregivers
AHCA's Medicaid page says Medicaid provides access to health care for low-income families and individuals and helps older adults and people with disabilities with nursing facility and other medical and long-term-care expenses. AHCA says it is responsible for administering SMMC, that most Florida Medicaid recipients are enrolled in SMMC, and that the program has Long-Term Care, Managed Medical Assistance, and Dental components. AHCA states that SMMC 3.0 was implemented on February 1, 2025, with new health and dental plan contracts. AHCA's covered-services and HCBS-waivers page indexes direct service overviews and HCBS waiver links, while the LTC page explains AHCA, DCF, and DOEA roles in coverage policy, financial eligibility, medical eligibility, level of care, screening, eligibility, enrollment, complaints, and fair hearings.
Why it matters
Florida caregivers need a high-level map before they can tell whether an issue belongs to DCF eligibility, DOEA level of care, an SMMC plan, AHCA policy, or a service-specific coverage rule. This row marks the official member-guidance layer for later service-specific explainers.
246

Florida MyACCESS Medicaid application and renewal implementation

ImplementationFlorida Medicaid application and renewal workflow verified July 4, 2026Live · Effectiveofficial · new

Florida DCF official materials explain that families use one application for assistance programs, the MyACCESS self-service portal lets customers connect with benefits information, people may apply for regular Medicaid online, long-term care applicants must indicate HCBS/Waivers or Nursing Home when needed, many renewals may be passive or ex parte, additional-information renewals use notice-driven MyACCESS updates, and DCF publishes renewal, change-reporting, documentation, and language-access instructions.

What changes for caregivers
DCF's public-benefits page says Florida uses one application for assistance programs and that the MyACCESS self-service portal lets customers connect with government assistance information around the clock. DCF's Medicaid page says individuals may apply for regular Medicaid and other services online, and that people needing long-term care in a nursing home or community setting must check HCBS/Waivers or Nursing Home on the Benefit Information screen. DCF's Medicaid redetermination materials say many cases may be automatically reviewed and approved through passive or ex parte renewal, while cases needing more information receive a notice before renewal with instructions. DCF tells recipients to update contact information, renew through MyACCESS after receiving a renewal notice, submit documentation, and use language assistance or other aids and services on request.
Why it matters
Florida coverage losses often happen at the workflow layer: address updates, notices, renewal timing, documentation, account access, and long-term-care application routing. This row anchors caregiver-facing Medicaid application and renewal workflow in official DCF sources.
247

Florida Medicaid statutory framework

LegislationFlorida Medicaid statutes verified July 4, 2026Live · Effectiveofficial · new

Florida Statutes Chapter 409 Part III designates AHCA as the single state agency for Title XIX medical-assistance payments, makes DCF responsible for Medicaid eligibility determinations, defines mandatory and optional Medicaid payment authority and services, and includes eligibility, payment, provider, reimbursement, managed-care, home health, home- and community-based services, and long-term-care-related authorities.

What changes for caregivers
Florida Statutes section 409.902 designates AHCA as the single state agency authorized to make medical-assistance payments under Title XIX, designates the program as Medicaid, and makes DCF responsible for Medicaid eligibility determinations, including policy, rules, SSI-related agreements, and actual determinations. Section 409.904 authorizes optional payments for eligible people subject to federal and state income, asset, and categorical tests and includes institutional, hospice, home- and community-based, medically needy, emergency, family-planning, child, premium, and related coverage categories. Section 409.905 identifies mandatory Medicaid service authority, including home health services and private duty nursing utilization management, and section 409.906 identifies optional service authority including home- and community-based services and assistive-care services.
Why it matters
Florida's statutory layer is the authority behind eligibility, service coverage, payment, managed care, and long-term-care implementation. This row gives Florida coverage explainers a legislative anchor before service-specific statutes are promoted.
248

Florida Medicaid rules, state plan, and provider materials

RegulationFlorida Medicaid regulatory materials verified July 4, 2026Live · Effectiveofficial · new

Florida AHCA official materials identify Medicaid administrative rules in the Florida Administrative Code, adopted general and service-specific policies, fee schedules, forms, provider policies, SMMC contract materials, federal authorities, waivers, State Plan sections, coverage policies, provider handbooks, eligibility guidelines, third-party liability, reimbursement protocols, and provider compliance materials.

What changes for caregivers
AHCA's Rules page says the Rules Unit supports Medicaid administrative rules in the Florida Administrative Code and provides access to adopted and in-process rules, incorporated coverage policies, fee schedules, forms, and drafts. AHCA's Medicaid Policy page says the Bureau of Policy develops and maintains federal authorities including the State Plan, 1115 waivers, HCBS waivers, administrative rules, coverage policies, and SMMC plan contracts; program policy includes eligibility guidelines, dual-eligible policy, third-party liability, CHIP, general provider information, and eligibility and reimbursement protocols; and the Rules function promulgates Medicaid rules, fee schedules, and coverage policies into the Florida Administrative Code. AHCA's State Plan page describes the plan as the written statement of Medicaid scope and nature and indexes eligibility, services, administration, hearings, manuals, provider agreements, utilization and quality control, payment, third-party liability, appeals, and related sections. AHCA's provider Policy Library says Florida Medicaid policies are codified as Division 59G administrative rules and includes adopted rules, general and service-specific policies, fee schedules, and SMMC information.
Why it matters
Florida coverage, provider participation, reimbursement, utilization review, managed-care operations, and service limits often turn on rules, State Plan sections, coverage policies, contracts, and provider materials rather than a single consumer page. This row anchors the Florida regulatory layer for later service and provider-operation explainers.
249

New York MAID physician reporting proposed rules

EnforcementProposed MAID physician reporting rules published June 3, 2026; comments due August 3, 2026Proposed · Proposedofficial · new

NYSDOH opened public comment on proposed physician reporting requirements for New York's Medical Aid in Dying law.

What changes for caregivers
NYSDOH announced a public comment period for proposed regulations establishing physician reporting requirements under the Medical Aid in Dying law. The proposed rulemaking would add Medical Aid in Dying physician reporting provisions to Title 10 NYCRR.
Why it matters
MAID implementation will turn on documentation, reporting, provider participation, and transfer rules. This row gives the corpus a separate compliance-watch anchor without treating proposed reporting rules as already final.
250

New York Medical Aid in Dying implementation

ImplementationEffective August 5, 2026Live · Effective Soonofficial · new

New York signed S.138/A.136 and is moving from passage to implementation for terminally ill adults who may request medical aid in dying.

What changes for caregivers
Medical aid in dying is moving into an implementation window, with patient-request safeguards, provider participation rules, and Department of Health preparation work becoming operational concerns.
Why it matters
Families and care organizations need plain-language explanation before the effective date, especially around eligibility, documentation, opt-outs, referrals, and caregiver roles.
251

ACT for ALS reauthorization push before September 2026 expiration

LegislationCurrent ACT for ALS authorization expires September 30, 2026Pending · Activeofficial plus tracker · new

Federal lawmakers and ALS organizations are pushing to reauthorize ACT for ALS programs before current authorization expires on September 30, 2026.

What changes for caregivers
The ACT for ALS Reauthorization Act of 2026 was introduced to extend programs tied to expanded access, ALS research, rare neurodegenerative disease action planning, and reporting.
Why it matters
For ALS families, federal program continuity can affect treatment-access pathways, research infrastructure, and advocacy urgency before the September 2026 deadline.
252

NJ FamilyCare federal eligibility changes

ImplementationFirst changes begin October 1, 2026Live · Effective Soonofficial · new

New Jersey is preparing members for federal Medicaid eligibility changes that begin in fall 2026 and continue into 2027.

What changes for caregivers
NJ FamilyCare warns that some eligibility rules change starting October 1, 2026, with community-engagement and six-month renewal changes beginning January 1, 2027 for certain adults.
Why it matters
Care recipients who lose coverage or miss renewal steps may also lose home care, medications, transport, or other supports caregivers rely on.
253

Federal ALS expanded-access research funding opportunity

BudgetApplications due November 10, 2026Pending · Activeofficial · new

NIH posted a 2026 funding opportunity for ALS intermediate-size patient-population expanded-access research, with applications due November 10, 2026.

What changes for caregivers
NIH/NINDS issued RFA-NS-26-001 to support scientific research using data from expanded access for investigational ALS drugs or biological products in intermediate-size patient populations.
Why it matters
Expanded-access research can affect treatment-access pathways and planning conversations for ALS families who are not eligible for ongoing clinical trials, while remaining distinct from benefits eligibility or guaranteed treatment access.
254

CMS Medicaid community-engagement interim final rule

RegulationStates generally implement no later than January 1, 2027Live · Effective Soonofficial · new

CMS issued an interim final rule for a new Medicaid community-engagement condition for certain adults, with state implementation generally due by January 1, 2027.

What changes for caregivers
CMS says states must implement an 80-hour monthly community-engagement requirement for certain Medicaid adults, with exemptions and state outreach requirements.
Why it matters
Coverage paperwork and renewal risk can cascade into loss of medications, home care, transportation, or other supports caregivers rely on.
255

Federal Medicaid eligibility and redetermination legislation

LegislationStates generally implement by January 1, 2027Live · Effectiveofficial · new

Public Law 119-21 added federal Medicaid eligibility changes, including six-month redeterminations for certain adults and statutory community-engagement requirements that CMS is implementing for 2027.

What changes for caregivers
Public Law 119-21 includes Medicaid eligibility-redetermination provisions for certain adults scheduled on or after the first quarter after December 31, 2026, and a statutory community-engagement requirement that CMS says states generally must implement no later than January 1, 2027.
Why it matters
This is the statutory source behind a national Medicaid paperwork and eligibility-risk lane; caregivers may need to track notices, exemptions, renewal timing, and loss-of-coverage risk before home care, medications, or transport are disrupted.
256

New York PFL construction-worker eligibility legislation

LegislationSigned December 19, 2025; effective January 1, 2027Passed · Signedofficial · new

New York signed legislation creating a Paid Family Leave eligibility standard for certain construction employees who work for multiple covered employers under a collective bargaining agreement.

What changes for caregivers
NY PFL's official news page says the signed construction bill creates a new eligibility standard for construction employees who work for multiple employers under a collective bargaining agreement, with eligibility after at least 26 of the last 39 weeks with a covered signatory employer and an effective date of January 1, 2027.
Why it matters
Construction workers can have fragmented employment histories; the new standard can affect whether a working caregiver in that sector can use PFL for family care once the change is implemented.
257

New York ALS and motor neuron disease registry

LegislationPublic registry website due by January 1, 2027Live · Implementingofficial · new

New York enacted an ALS and motor neuron disease registry with provider reporting, patient notice, opt-out, confidentiality rules, and a public website deadline.

What changes for caregivers
New York signed Chapter 478 of 2025 requiring DOH to establish an ALS and motor neuron disease registry with provider reporting, patient notice, opt-out process, confidentiality rules, and a public website deadline.
Why it matters
ALS families face fast-moving care needs; better incidence and prevalence data can affect state service planning and research pathways without changing benefits by itself.
258

New York frontotemporal degeneration registry

LegislationPublic registry website due by January 1, 2027Live · Implementingofficial · new

New York enacted a frontotemporal degeneration registry and directed DOH to publish registry information and family resources through a public webpage.

What changes for caregivers
New York signed Chapter 479 of 2025 establishing an FTD registry and directing DOH to publish registry information and family resources through a public webpage.
Why it matters
FTD is often misdiagnosed and heavily caregiver-intensive; the row connects neurodegenerative disease policy to diagnosis delay, family resource navigation, and public data.
259

Washington Apple Health renewal changes

ImplementationSix-month renewals expected January 1, 2027 for some adultsLive · Effective Soonofficial · new

Washington HCA says Apple Health coverage can be renewed through Washington Healthplanfinder, with federal changes expected to alter renewal frequency for some adults in 2027.

What changes for caregivers
Washington HCA maintains Apple Health application and renewal pathways and warns that some adult Apple Health members are expected to face six-month renewal and community-engagement changes starting January 1, 2027.
Why it matters
More frequent renewal cycles create more paperwork checkpoints and more chances for coverage loss, which can affect care access and caregiver planning.
260

Maryland FAMLI paid family and medical leave implementation

ImplementationEmployer preparation before January 2028 benefitsLive · Effective Soonofficial · new

Maryland's FAMLI program is preparing to provide paid, job-protected leave for eligible workers, including leave to care for a loved one, with benefits starting in January 2028.

What changes for caregivers
Maryland is building its paid family and medical leave program, with employer preparation and payroll/contribution steps preceding employee benefits that begin in January 2028.
Why it matters
Caregivers need early notice because program eligibility, payroll deductions, employer communications, and future leave applications all become planning issues before benefits are payable.
261

Maryland Medicaid renewal and 2027 check-in changes

ImplementationSix-month Medicaid check-ins expected January 1, 2027Live · Effective Soonofficial · new

Maryland Health Connection says Medicaid and MCHP enrollees generally renew every 12 months now, with new federal Medicaid check-in rules coming in 2027.

What changes for caregivers
Maryland Health Connection maintains Medicaid renewal routing now and is warning members that new federal Medicaid check-in rules are expected in 2027.
Why it matters
More frequent Medicaid renewal checkpoints increase paperwork, account access, and deadline-management burdens for caregivers who manage benefits.
262

Illinois Palliative Care and Quality of Life Act proposal

LegislationProposed rules deadline January 1, 2027 if enactedProposed · Proposedofficial · new

Illinois HB5476 would create a Palliative Care and Quality of Life Act and require the Department of Public Health to publish proposed implementation rules by January 1, 2027.

What changes for caregivers
Illinois lawmakers introduced a bill that would create standards for community-based palliative care services and a public awareness and education program.
Why it matters
Palliative-care access is a serious-illness lever that affects whether families get symptom support, goals-of-care conversations, and care coordination before crisis points.
263

Washington HB 2225 AI companion chatbots

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Requires clear and recurring AI companion disclosures, minor protections, limits on manipulative engagement, self-harm protocols, and public protocol reporting.

What changes for caregivers
Requires clear and recurring AI companion disclosures, minor protections, limits on manipulative engagement, self-harm protocols, and public protocol reporting.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
264

Connecticut SB 5 artificial intelligence omnibus law

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Includes companion chatbot duties, including notice, protections around sustained engagement, and safety expectations for vulnerable users.

What changes for caregivers
Includes companion chatbot duties, including notice, protections around sustained engagement, and safety expectations for vulnerable users.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
265

Oregon SB 1546 artificial intelligence companions

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Requires notice that users are interacting with artificial output, self-harm detection and response protocols, minor safeguards, annual reports, and user actions for ascertainable harm.

What changes for caregivers
Requires notice that users are interacting with artificial output, self-harm detection and response protocols, minor safeguards, annual reports, and user actions for ascertainable harm.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
266

Colorado SB26-189 automated decision-making technology

LegislationEffective 2027-01-01Live · Effective Soonofficial · updated

Repeals and reenacts Colorado AI Act provisions as an automated decision-making technology framework with transparency and consumer-rights obligations.

What changes for caregivers
Repeals and reenacts Colorado AI Act provisions as an automated decision-making technology framework with transparency and consumer-rights obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
267

Idaho S 1297 Conversational Artificial Intelligence Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Adopts conversational AI safety requirements for public conversational AI services, including disclosure and youth-safety obligations.

What changes for caregivers
Adopts conversational AI safety requirements for public conversational AI services, including disclosure and youth-safety obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
268

Nebraska LB 525 Conversational Artificial Intelligence Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Adopts the Conversational Artificial Intelligence Safety Act, defining public conversational AI services and related operator obligations.

What changes for caregivers
Adopts the Conversational Artificial Intelligence Safety Act, defining public conversational AI services and related operator obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
269

Iowa SF 2417 Conversational Artificial Intelligence Safety Act

LegislationApplies 2027-07-01Live · Effective Soonofficial · updated

Adopts public conversational AI service requirements, including operator duties for disclosure and safety.

What changes for caregivers
Adopts public conversational AI service requirements, including operator duties for disclosure and safety.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
270

Georgia SB 540 Online Internet Safety Act

LegislationEffective 2027-07-01Live · Effective Soonofficial · updated

Creates duties for public conversational AI services, including disclosure and child-safety requirements for certain AI interactions.

What changes for caregivers
Creates duties for public conversational AI services, including disclosure and child-safety requirements for certain AI interactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
271

CMS Medicaid Access Rule HCBS implementation

RegulationState HCBS payment reporting phase-in starts July 9, 2027Live · Implementingofficial · updated

CMS is phasing in national Medicaid access requirements for HCBS reporting, service timeliness, waiting lists, and direct-care payment standards.

What changes for caregivers
CMS finalized the Medicaid Access Rule, including HCBS reporting on waiting lists and service timeliness plus phased direct-care compensation reporting and an eventual 80 percent payment-adequacy standard for certain HCBS services.
Why it matters
This is a national implementation lane for whether Medicaid home-care dollars reach the workforce and whether states can show HCBS access problems clearly.
272

CMS HCBS Access Rule implementation roadmap

ImplementationKey HCBS Access Rule milestones begin July 9, 2027Live · Implementingofficial · new

CMS maps phased Medicaid HCBS Access Rule implementation dates for grievance systems, incident management, quality reporting, waiting-list reporting, transparency, and direct-care payment requirements.

What changes for caregivers
CMS's policy implementation roadmap and applicability-date chart identify phased HCBS Access Rule milestones, including HCBS website transparency, incident management, waiting-list and access reporting, HCBS Quality Measure Set reporting, and direct-care-worker payment adequacy requirements.
Why it matters
Many caregiver-facing impacts of the Access Rule will appear through state implementation timelines, reporting systems, grievance operations, and direct-care workforce spending rather than through one immediate national change.
273

CMS HCBS grievance enforcement-discretion period

EnforcementEnforcement discretion runs until December 31, 2027Pending · Activeofficial · new

CMS is using enforcement discretion for Medicaid fee-for-service HCBS grievance-system requirements until December 31, 2027.

What changes for caregivers
CMS announced that it does not anticipate taking enforcement action against states for Medicaid fee-for-service HCBS grievance-system requirements until December 31, 2027, while continuing to monitor person-centered service planning and HCBS settings compliance through existing oversight mechanisms.
Why it matters
The grievance system is supposed to give HCBS beneficiaries a route to report problems with person-centered planning and settings requirements, but the enforcement-discretion period changes the near-term implementation posture for states and families.
274

Federal 1915(c) HCBS waiver expansion

LegislationStandalone 1915(c) HCBS waiver option begins July 1, 2028Live · Effective Soonofficial · new

Public Law 119-21 creates a future Medicaid 1915(c) pathway allowing CMS to approve standalone HCBS waivers beginning July 1, 2028.

What changes for caregivers
Public Law 119-21 section 71121 amends section 1915(c) of the Social Security Act so that, beginning July 1, 2028, the Secretary may approve a standalone waiver for home or community-based services under specified conditions, including a state showing that approval will not materially increase wait times for people under other 1915(c) waivers.
Why it matters
This creates a future federal HCBS pathway that states may choose to pursue. The caregiver-facing question is not immediate eligibility, but whether and how states design new waiver options before the 2028 effective date.
275

CMS Nursing Home Staffing Campaign implementation

ImplementationPhased implementation during 2026; CMS expects financial incentive administrators in summer 2026Live · Implementingofficial · new

CMS is implementing a national Nursing Home Staffing Campaign to recruit nurses into nursing homes and state inspection agencies through incentives, training pathways, state collaboration, and career outreach.

What changes for caregivers
CMS is implementing a national staffing campaign with nurse financial incentives, enhanced CNA training pathways, a nurse recruitment webpage, collaboration with states, and financial incentive administrators to support RN/LPN recruitment into nursing homes and state inspection agencies.
Why it matters
Staffing is a core quality signal for families; implementation details affect whether workforce supports reach facilities and state inspectors that protect residents' health and safety.
276

New York Health Information Privacy Act proposal

LegislationActive 2025-2026 sessionPending · Activeofficial · new

New York's S.929 would create state rules for regulated health information collected by apps, websites, devices, and other non-HIPAA health-data systems.

What changes for caregivers
S.929 remains an active New York proposal to regulate health information beyond traditional HIPAA-covered settings, including consent, notices, deletion, and data-security obligations.
Why it matters
Caregiver tools often collect sensitive context outside a clinical record; this proposal is a direct watch item for health-data handling, consent design, and deletion workflows.
277

HHS HIPAA family and caregiver disclosure guidance

GuidanceCurrent HHS OCR guidance; no single effective-date eventPending · Activeofficial · new

HHS OCR guidance explains when HIPAA allows providers and plans to share relevant health information with family members, friends, personal representatives, and others involved in a patient's care or payment for care.

What changes for caregivers
HHS OCR maintains caregiver-relevant HIPAA guidance explaining that covered entities may share information directly relevant to a family member's or friend's involvement in care or payment, may notify people responsible for care about location, condition, or death, and treat personal representatives as the individual for relevant health-care matters.
Why it matters
Caregivers often need enough health information to coordinate care, pick up medications, support discharge, or communicate with clinicians; the guidance helps separate permitted sharing from situations that require patient choice, professional judgment, or state-law representative authority.
278

Maine AI chatbot disclosure in consumer transactions

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Requires clear and conspicuous notice when an AI chatbot may mislead a reasonable consumer into believing they are engaging with a human.

What changes for caregivers
Requires clear and conspicuous notice when an AI chatbot may mislead a reasonable consumer into believing they are engaging with a human.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
279

Maine LD 2082 AI in mental health services

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Public Law Chapter 687 regulates the use of AI in providing certain mental health services and limits therapy or psychotherapy use to licensed professional oversight.

What changes for caregivers
Public Law Chapter 687 regulates the use of AI in providing certain mental health services and limits therapy or psychotherapy use to licensed professional oversight.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
280

Massachusetts S264 AI chatbot consumer protections

LegislationActive sessionProposed · Proposedofficial · updated

Would establish protections for consumers interacting with artificial intelligence chatbots.

What changes for caregivers
Would establish protections for consumers interacting with artificial intelligence chatbots.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
281

Massachusetts S2632 AI in healthcare decision-making

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of AI and other software tools in healthcare decision-making.

What changes for caregivers
Would regulate the use of AI and other software tools in healthcare decision-making.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
282

Massachusetts S250 consumer health data proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would establish consumer health data protections relevant to non-HIPAA care and wellness applications.

What changes for caregivers
Would establish consumer health data protections relevant to non-HIPAA care and wellness applications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
283

Montana SB 163 biometric, genetic, and neural data privacy

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Revises privacy law related to biometric, genetic, and neural data.

What changes for caregivers
Revises privacy law related to biometric, genetic, and neural data.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
284

South Dakota SB 168 chatbot use by minors

LegislationActive sessionPending · Activeofficial · updated

Would have regulated chatbot use by minors; deferred to the 41st legislative day.

What changes for caregivers
Would have regulated chatbot use by minors; deferred to the 41st legislative day.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
285

South Dakota SB 170 chatbot consumer notice

LegislationActive sessionPending · Activetracker only · updated

Would have required notice to consumers interacting with human-simulating chatbots or computer technologies.

What changes for caregivers
Would have required notice to consumers interacting with human-simulating chatbots or computer technologies.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
286

Minnesota SF4997 AI chatbot technology requirements

LegislationActive sessionProposed · Proposedofficial · updated

Would establish requirements for artificial intelligence chatbot technology.

What changes for caregivers
Would establish requirements for artificial intelligence chatbot technology.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
287

Minnesota HF3893 AI psychotherapy regulation

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate use of artificial intelligence in psychotherapy services and provide civil penalties.

What changes for caregivers
Would regulate use of artificial intelligence in psychotherapy services and provide civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
288

Minnesota HF2700 consumer health data protections

LegislationActive sessionProposed · Proposedtracker only · updated

Would modify the Minnesota Consumer Data Privacy Act to treat consumer health data as sensitive data and add protections.

What changes for caregivers
Would modify the Minnesota Consumer Data Privacy Act to treat consumer health data as sensitive data and add protections.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
289

Wisconsin SB 1066 AI prior authorization proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate use of AI to deny prior authorization for medical necessity or experimental status.

What changes for caregivers
Would regulate use of AI to deny prior authorization for medical necessity or experimental status.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
290

Wisconsin AB 965 child relationship-AI bill

LegislationActive sessionPending · Activeofficial · updated

Would have regulated AI systems that simulate humanlike relationships with children; failed to pass in 2026.

What changes for caregivers
Would have regulated AI systems that simulate humanlike relationships with children; failed to pass in 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
291

Michigan SB 760 companion chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Tracked as a direct companion chatbot bill with disclosure and safety implications for AI systems that simulate relationship-like engagement.

What changes for caregivers
Tracked as a direct companion chatbot bill with disclosure and safety implications for AI systems that simulate relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
292

Connecticut Consumer health data statute

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Defines consumer health data to include data used to identify a consumer physical or mental health condition or diagnosis.

What changes for caregivers
Defines consumer health data to include data used to identify a consumer physical or mental health condition or diagnosis.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
293

Connecticut SB 86 companion chatbot bill analysis

LegislationActive sessionProposed · Proposedofficial · updated

2026 bill analysis describes disclosure duties and restrictions for operators that make companion chatbots available to certain minors.

What changes for caregivers
2026 bill analysis describes disclosure duties and restrictions for operators that make companion chatbots available to certain minors.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
294

Rhode Island S2195 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion AI chatbot operators, including disclosure, minor-safety, and crisis-response obligations.

What changes for caregivers
Would regulate companion AI chatbot operators, including disclosure, minor-safety, and crisis-response obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
295

Rhode Island H7350 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

House companion proposal covering AI chatbots used for companionship or relationship-like engagement.

What changes for caregivers
House companion proposal covering AI chatbots used for companionship or relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
296

Indiana HB 1271 payment of health claims

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Prohibits providers from using an automated process, system, or tool to submit a health benefits claim without review by a provider or another responsible person.

What changes for caregivers
Prohibits providers from using an automated process, system, or tool to submit a health benefits claim without review by a provider or another responsible person.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
297

Ohio HB 525 AI in therapy services

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate the use of artificial intelligence in therapy services.

What changes for caregivers
Would regulate the use of artificial intelligence in therapy services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
298

Ohio SB 164 AI use by health insurers

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of artificial intelligence by health insurers.

What changes for caregivers
Would regulate the use of artificial intelligence by health insurers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
299

Pennsylvania HB 2006 chatbot use in consumer transactions

LegislationActive sessionProposed · Proposedtracker only · updated

Proposed chatbot disclosure bill in consumer transactions.

What changes for caregivers
Proposed chatbot disclosure bill in consumer transactions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
300

Pennsylvania SAFECHAT Act

LegislationActive sessionProposed · Proposedofficial · updated

Minor-focused AI chatbot safeguard proposal advanced by the Pennsylvania Senate in 2026.

What changes for caregivers
Minor-focused AI chatbot safeguard proposal advanced by the Pennsylvania Senate in 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
301

New Jersey A4732 companion chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion chatbots and establish user notice and safety expectations for AI systems that simulate relationship-like engagement.

What changes for caregivers
Would regulate companion chatbots and establish user notice and safety expectations for AI systems that simulate relationship-like engagement.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
302

New Jersey S735 therapeutic chatbots and social AI companions

LegislationActive sessionProposed · Proposedofficial · updated

Proposed bill regulating therapeutic chatbots and social AI companions.

What changes for caregivers
Proposed bill regulating therapeutic chatbots and social AI companions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
303

Utah HB 452 mental health chatbots

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Defines mental health chatbots, requires AI and non-human disclosures, limits sale/sharing of user input and health information, restricts targeted ads, and creates policy and documentation requirements.

What changes for caregivers
Defines mental health chatbots, requires AI and non-human disclosures, limits sale/sharing of user input and health information, restricts targeted ads, and creates policy and documentation requirements.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
304

Kansas HB 2671 companion AI chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Defines companion AI chatbot around companionship or mental-health therapeutic communication and proposes related safeguards.

What changes for caregivers
Defines companion AI chatbot around companionship or mental-health therapeutic communication and proposes related safeguards.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
305

Missouri HB 2032 companion chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion AI chatbot operators and safety obligations for AI systems used for companionship or therapeutic communication.

What changes for caregivers
Would regulate companion AI chatbot operators and safety obligations for AI systems used for companionship or therapeutic communication.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
306

Kentucky HB 227 companion AI chatbots

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate companion AI chatbot operators, including disclosures and safeguards around minor users and therapeutic communications.

What changes for caregivers
Would regulate companion AI chatbot operators, including disclosures and safeguards around minor users and therapeutic communications.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
307

West Virginia HB 4770 mental health care AI limitations

LegislationActive sessionProposed · Proposedofficial · updated

Would limit use of AI and AI technology to deliver mental health care, while allowing certain administrative support functions.

What changes for caregivers
Would limit use of AI and AI technology to deliver mental health care, while allowing certain administrative support functions.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
308

Maryland HB 952 companion chatbot safeguards

LegislationActive sessionProposed · Proposedofficial · updated

Would require companion chatbot disclosures, suicide and self-harm response protocols, and related operator obligations.

What changes for caregivers
Would require companion chatbot disclosures, suicide and self-harm response protocols, and related operator obligations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
309

Arizona HB 2737 chatbot regulations

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate chatbot personal-data practices and requirements for consumer-facing chatbot systems.

What changes for caregivers
Would regulate chatbot personal-data practices and requirements for consumer-facing chatbot systems.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
310

Arizona HB 2311 AI service disclosures

LegislationActive sessionProposed · Proposedtracker only · updated

Would require disclosures and related requirements for artificial intelligence services.

What changes for caregivers
Would require disclosures and related requirements for artificial intelligence services.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
311

New Mexico HB 174 Chatbot Safety Act

LegislationActive sessionPending · Activeofficial · updated

Would have created chatbot safety requirements; action was postponed indefinitely in January 2026.

What changes for caregivers
Would have created chatbot safety requirements; action was postponed indefinitely in January 2026.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
312

Oklahoma HB 3544 AI companions and minors

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate artificial intelligence companions, minors, safety requirements, and civil penalties.

What changes for caregivers
Would regulate artificial intelligence companions, minors, safety requirements, and civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
313

Oklahoma SB 1521 AI minor safeguards and disclosure

LegislationActive sessionProposed · Proposedofficial · updated

Would require AI operator disclosures, preventive measures for minor account holders, prohibitions, attorney general enforcement, and civil penalties.

What changes for caregivers
Would require AI operator disclosures, preventive measures for minor account holders, prohibitions, attorney general enforcement, and civil penalties.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
314

Oklahoma SB 2037 AI informed consent in health care

LegislationActive sessionProposed · Proposedofficial · updated

Would require informed consent for AI use by licensed mental health professionals or health care providers and define authorized and prohibited uses.

What changes for caregivers
Would require informed consent for AI use by licensed mental health professionals or health care providers and define authorized and prohibited uses.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
315

Virginia SB 796 Artificial Intelligence Companion Chatbots and Minors Act

LegislationActive sessionProposed · Proposedofficial · updated

Would require age verification for companion chatbots, loyalty-oriented safeguards for widely used chatbots, crisis resource actions, and incident reporting.

What changes for caregivers
Would require age verification for companion chatbots, loyalty-oriented safeguards for widely used chatbots, crisis resource actions, and incident reporting.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
316

North Carolina S 624 AI chatbots

LegislationActive sessionProposed · Proposedofficial · updated

Tracked as pending AI chatbot regulation in 2026 state legislation trackers.

What changes for caregivers
Tracked as pending AI chatbot regulation in 2026 state legislation trackers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
317

Louisiana SB 5 mental health chatbot proposal

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate mental health chatbots that use artificial intelligence technology.

What changes for caregivers
Would regulate mental health chatbots that use artificial intelligence technology.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
318

Louisiana HB 1188 chatbot protections for minors

LegislationActive sessionProposed · Proposedofficial · updated

Would provide protections for minors regarding use of chatbots.

What changes for caregivers
Would provide protections for minors regarding use of chatbots.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
319

Louisiana HB 197 AI use by health care providers

LegislationActive sessionProposed · Proposedtracker only · updated

Would regulate the use of artificial intelligence by health care providers.

What changes for caregivers
Would regulate the use of artificial intelligence by health care providers.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
320

Mississippi HB 1720 mental and behavioral health AI proposal

LegislationActive sessionPending · Activeofficial · updated

Would have prohibited use of artificial intelligence in professional mental and behavioral health care.

What changes for caregivers
Would have prohibited use of artificial intelligence in professional mental and behavioral health care.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
321

Alabama SB 63 health care plan AI determinations

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Regulates the use of artificial intelligence by health care plans in coverage or care-service determinations.

What changes for caregivers
Regulates the use of artificial intelligence by health care plans in coverage or care-service determinations.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
322

Alabama HB 324 chatbot and therapy-chatbot requirements

LegislationActive sessionProposed · Proposedofficial · updated

Would require chatbot age verification, safeguard protocols, therapy-chatbot requirements, and enforcement paths.

What changes for caregivers
Would require chatbot age verification, safeguard protocols, therapy-chatbot requirements, and enforcement paths.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
323

Alabama HB 263 biological and neural data proposal

LegislationActive sessionProposed · Proposedtracker only · updated

Would restrict certain disclosures, transfers, and uses of biological or neural data by health and fitness apps without express consent.

What changes for caregivers
Would restrict certain disclosures, transfers, and uses of biological or neural data by health and fitness apps without express consent.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
324

South Carolina S0896 chatbot regulation

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate chatbot systems and related consumer protections.

What changes for caregivers
Would regulate chatbot systems and related consumer protections.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
325

South Carolina S1037 protecting children from chatbots

LegislationActive sessionProposed · Proposedofficial · updated

Would establish protections for children from chatbot harms.

What changes for caregivers
Would establish protections for children from chatbot harms.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
326

South Carolina S0788 artificial intelligence and therapy or psychotherapy

LegislationActive sessionProposed · Proposedofficial · updated

Would regulate artificial intelligence in therapy or psychotherapy contexts.

What changes for caregivers
Would regulate artificial intelligence in therapy or psychotherapy contexts.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
327

Hawaii SB 640 AI disclosure requirements

LegislationActive sessionProposed · Proposedtracker only · updated

Introduced/proposed AI disclosure bill tracked as an adjacent transparency signal.

What changes for caregivers
Introduced/proposed AI disclosure bill tracked as an adjacent transparency signal.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
328

Florida HB 659 interactions with artificial intelligence

LegislationActive sessionPending · Activeofficial · updated

Would have required companion chatbot platform disclosures, safety protocols, age verification actions for minors, reports, and consumer enforcement paths.

What changes for caregivers
Would have required companion chatbot platform disclosures, safety protocols, age verification actions for minors, reports, and consumer enforcement paths.
Why it matters
Digital support tools for caregivers may need to explain their role, data use, safety boundaries, or escalation limits differently in this jurisdiction.
329

Federal S.2714 CHAT Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.

What changes for caregivers
Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
330

Federal S.3062 GUARD Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.

What changes for caregivers
Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
331

Federal Stopping Illegal Minor Simulations Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.

What changes for caregivers
Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
332

Federal H.R.6489 SAFE BOTs Act

LegislationActive sessionProposed · Proposedofficial · updated

Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.

What changes for caregivers
Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
333

Federal ONC HTI-1 algorithm transparency rule

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.

What changes for caregivers
Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
334

Federal HIPAA Security Rule cybersecurity NPRM

LegislationActive sessionProposed · Proposedofficial · updated

Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.

What changes for caregivers
Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.
335

Federal DOJ sensitive personal data final rule

LegislationNo dated trigger capturedLive · Effectiveofficial · updated

Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.

What changes for caregivers
Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.
Why it matters
Federal movement can shape baseline expectations for care-adjacent AI, health data, minor safety, and clinical transparency even before one comprehensive standard exists.

care policy rows

335

care policy jurisdictions

50

AI map high-signal states

40 / 51

AI map enacted or scheduled

21 / 51

Radar scope

Policy changes that alter care burden and action.

GiveCare tracks policy and systems changes that alter what families, advocates, care organizations, and partners have to understand, decide, document, or fight for. AI policy is one lane inside the broader care systems feed.

01

End of life and serious illness

MAID, palliative care, hospice, advance directives, grief, and state effective dates.

02

Rare disease, chronic illness, and disability

ALS, Parkinson's, dementia, neurodegenerative disease, registries, disability access, and specialty-care pathways.

03

Caregiver economic support

Paid leave, tax credits, respite grants, family caregiver supports, and direct cash relief.

04

Home care and long-term services

Medicaid HCBS, CDPAP, paid family care, direct-care workforce, respite, and in-home service capacity.

05

Benefits, coverage, and access

Medicaid, Medicare, VA supports, eligibility rules, appeals, coverage limits, and program navigation.

06

Legal authority and family rights

Caregiver access, proxy authority, guardianship, privacy, discharge rights, and decision documentation.

07

AI, data, and care technology

Chatbot regulation, clinical AI, biometric access, surveillance, health-data use, and algorithmic eligibility.

08

Advocacy opportunities

Hearings, comment periods, sign-on letters, advocacy days, sponsors, committees, and coalitions.

09

Implementation changes

The practical dates and rules that change what families, care orgs, or advocates can do.

Impact taxonomy

The lens is care burden before bill status.

The radar reads each item for the pressure it creates or relieves: family psychology, access, legal authority, disease pathways, service capacity, data exposure, advocacy timing, and implementation reality.

Family burden and psychology

role straindecision fatigueanticipatory griefambiguous lossmoral distressidentity strain

Access and eligibility

MedicaidHCBSCDPAPMedicareVA supportspaperwork load

Legal authority and decision rights

caregiver accesssurrogate decisionsadvance directivesguardianshipMAIDprivacy proxies

Disease and serious-illness pathways

ALSParkinson'sdementiaregistriespalliative carehospice

Home-care capacity

respitepaid family caredirect-care workforceleavetax credits

Data, AI, and surveillance

chatbotsclinical AIhealth databiometricsmonitoringalgorithmic eligibility

Advocacy and implementation

sponsorscommitteeshearingscomment windowseffective datesagency guidance

Policy mechanics

The movement can be a bill, a rule, a budget line, or a deadline.

The radar classifies each item by how change actually happens. A passed law matters less if implementation is years away; a comment period or budget line can be the place where advocates still have leverage.

Legislation

draft billsponsorcommitteehearingmarkupfloor votesigned / vetoed

Rulemaking and regulation

proposed rulepublic commentfinal ruleagency guidancecompliance date

Budget and payment

appropriationgrantwaiverreimbursement ratepilot fundingsunset

Program administration

eligibility ruleapplication formtrainingimplementation dateappeal path

Oversight and enforcement

auditinvestigationombudsenforcement actionreporting requirement

Courts and legal pressure

lawsuitinjunctionsettlementcourt rulingconsent decree

Initial filters

ALS / rare disease / chronic illnessCaregiver supportMAID / serious illnessMedicaid / HCBS / home careLegal rights / decision authorityAI / privacy / care techNY / NJ / federal

Impact route

WatchExplainAdd to wikiPartner briefAdvocacy follow-upScenario / eval

AI / data / privacy lane

Where AI-supported care regulation is moving

The first populated lane tracks state and federal AI, chatbot, health-data, and disclosure rules that may shape caregiver support tools.

AKMEVTNHMAWAMTNDSDMNWIMINYCTRIORIDWYNEIAILINOHPANJCANVUTCOKSMOKYWVDCMDDEAZNMOKARTNVANCTXLAMSALGASCHIFL
No targeted rule captured
Adjacent proposal
Direct proposal
Binding adjacent rule
Direct enacted or scheduled rule

Scope

AI/data/privacy lane: 50 states plus DC; federal context below.

Publication rule

Official source preferred; tracker items are labeled.

Boundary

Research map only. Not legal advice.

Care standard

The AI laws are close to care, but not the whole care standard.

State bills are converging on disclosure, minors, self-harm, therapy boundaries, and sensitive data. Caregiving systems also need to account for benefits access, family burden, serious illness decisions, and implementation dates families actually feel.

01

Identity clarity

Recurring AI/not-human disclosure and resistance to identity ambiguity.

DisclosureCompanion Chatbot
02

Crisis response

Self-harm detection, crisis referrals, escalation protocol, and public reporting.

Crisis SafetyMental Health Chatbot
03

Relationship boundaries

Controls for dependency cues, manipulative engagement, minors, and simulated intimacy.

Minor SafetyCompanion Chatbot
04

Data and oversight

Consumer health data limits, health AI transparency, impact assessment, and human review.

Consumer Health DataHealthcare AiHigh Risk AiData Governance

Federal AI/data context

No single federal AI-supported care standard yet.

Federal signals are split across chatbot/minor bills, health IT transparency, HIPAA cybersecurity, and sensitive data rules. The broader radar also tracks federal caregiver support, benefits access, and disease-specific bills.

ProposedDirect care-adjacent

S.2714 CHAT Act

Federal proposal targeting companion AI chatbots used by minors, including restrictions on access and harmful dialogue.

ProposedDirect care-adjacent

S.3062 GUARD Act

Federal proposal defining AI companions and focusing on minors, non-human disclosure, age verification, and sexual-content harms.

Proposedadjacent

Stopping Illegal Minor Simulations Act

Federal proposal to prohibit covered chatbot operators from making available minor-simulating chatbots that engage in sexually explicit conduct or conversation.

Introduced June 10, 2026 by Sens. Husted, Coons, Cassidy, and Murphy; draft bill text posted by Sen. Husted.

ProposedDirect care-adjacent

H.R.6489 SAFE BOTs Act

Federal proposal including chatbot crisis-resource disclosures and a four-year longitudinal study of chatbot mental-health risks and benefits for minors.

Enactedadjacent

ONC HTI-1 algorithm transparency rule

Final rule updates health IT certification and includes algorithm transparency requirements for certified health IT.

Proposedcontext

HIPAA Security Rule cybersecurity NPRM

Proposed federal rule to strengthen cybersecurity requirements for electronic protected health information.

Enactedcontext

DOJ sensitive personal data final rule

Final rule restricting certain transactions involving U.S. sensitive personal data and government-related data with countries of concern.

Method

Wide scrub, curated feed.

Civic discovery

0 raw Civic signals were fetched for the AI/data lane on 2026-06-17T12:04:20Z. Hound keeps raw results nonpublishable until they are normalized, evidence-bound, reviewed, and applied through an approved plan.

Official-source bias

Published entries prefer state legislature, agency, Federal Register, Congress.gov, or official bill text. Tracker sources are marked where the official source is still being resolved.

Care systems scope

Items belong when they change what families, advocates, care organizations, or partners have to understand, decide, document, or fight for. AI, data, and privacy are one lane inside that broader scope.

Update posture

This is designed as a monitored policy layer. New civic sweeps should feed a review queue before the public map changes tier or status.

Changelog

What changed in the radar.

Material updates are logged here so source coverage, lane scope, and tier movement can be audited over time.

2026-07-04

Official-source backfill for state AI-policy signals

Added official legislature source URLs to tracker-backed state AI-policy signals without changing status, relation, or public classification.

  • Backfilled official bill pages or bill text for 27 state signals that were previously tracker-only.
  • Kept tracker links as secondary provenance and left any legal interpretation or status strengthening to future review.

2026-06-17

Targeted federal minor-safety refresh

Ran the civic policy sweep for post-June-5 signals and added one official federal adjacent signal from a targeted web cross-check.

  • Civic returned zero structured signals for the June 5 to June 17 window.
  • Added the SIMS Act as adjacent minor-safety context because it targets minor-simulating chatbots rather than caregiving, eligibility, or clinical claims.
  • Left state entries unchanged because no newer official state signal cleared the existing publication standard.

2026-06-05

50-state plus DC refresh

Reviewed every state and DC, expanded the public layer to 45 non-baseline jurisdictions, and left Alaska, Arkansas, Delaware, North Dakota, Wyoming, and DC as baseline pending new targeted signals.

  • Added enacted or scheduled chatbot and healthcare-AI entries for Connecticut, Georgia, Idaho, Iowa, Nebraska, and New Hampshire.
  • Added or refreshed proposal clusters in Alabama, Arizona, Louisiana, Massachusetts, Minnesota, Ohio, Oklahoma, South Carolina, West Virginia, and related monitoring states.
  • Moved dead or postponed child-chatbot proposals in Florida, Mississippi, New Mexico, South Dakota, and Wisconsin into monitor status instead of treating them as active direct rules.

2026-05-20

Tracked review window opened

Started the civic discovery window used by the public policy map and normalized visible items against state, federal, and legislative-tracker sources.

  • Structured the page around all 50 states plus DC, federal context, source links, and a standard-gap explanation.
  • Established direct, adjacent, context, and monitor classifications for care-AI policy signals.